BLASTX nr result
ID: Cephaelis21_contig00036179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036179 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18053.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002276629.1| PREDICTED: uncharacterized protein LOC100248... 55 8e-06 >emb|CBI18053.3| unnamed protein product [Vitis vinifera] Length = 300 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -2 Query: 302 CYLSLNSDEYHGLIIKAFEQVWFNMPDLNL*KRNFQF 192 CYLSLNSDEYH +IIK F+Q+WF++PD++ N++F Sbjct: 246 CYLSLNSDEYHDIIIKVFKQIWFDIPDVHNKHHNYKF 282 >ref|XP_002276629.1| PREDICTED: uncharacterized protein LOC100248417 [Vitis vinifera] Length = 387 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 302 CYLSLNSDEYHGLIIKAFEQVWFNMPDLNL 213 CYLSLNSDEYH LI+KAFEQ+WF+ DL + Sbjct: 358 CYLSLNSDEYHDLIVKAFEQIWFDTSDLRM 387