BLASTX nr result
ID: Cephaelis21_contig00035280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035280 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278797.1| PREDICTED: uncharacterized protein LOC100252... 67 2e-09 gb|AFI57511.1| NEP-TC [Solanum betaceum] 66 3e-09 gb|AAA79704.1| OBP33pep, partial [Arabidopsis thaliana] 66 3e-09 emb|CAB45991.1| OBP33pep like protein [Arabidopsis thaliana] gi|... 66 3e-09 ref|NP_193287.1| tRNA/rRNA methyltransferase (SpoU) family prote... 66 3e-09 >ref|XP_002278797.1| PREDICTED: uncharacterized protein LOC100252797 [Vitis vinifera] gi|147777374|emb|CAN73835.1| hypothetical protein VITISV_043470 [Vitis vinifera] gi|297736948|emb|CBI26149.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = -1 Query: 509 PVKQVRRSFCAETSESISEERRLKRESNSSGFFDQSGKDESSSSNLLDGLFG 354 P +QVRR++C ET++SI EER+++R++ S+GFFD+SG E S SNLLD LFG Sbjct: 166 PAQQVRRNYCTETADSIIEERKIRRQNASNGFFDESGSGE-SPSNLLDALFG 216 >gb|AFI57511.1| NEP-TC [Solanum betaceum] Length = 221 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = -1 Query: 509 PVKQVRRSFCAETSESISEERRLKRESNSSGFFDQSGKDESSSSNLLDGLF 357 P KQ ++++C ETSES++EERRLK+E+ S+GFF+ +GK+E S SNLLD LF Sbjct: 170 PFKQAKKNYCMETSESVAEERRLKKENLSNGFFEDTGKEE-SPSNLLDTLF 219 >gb|AAA79704.1| OBP33pep, partial [Arabidopsis thaliana] Length = 210 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/52 (61%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -1 Query: 509 PVKQVRRSFCAETSESISEERRLKRESNSSGFFDQSGKDE-SSSSNLLDGLF 357 PV+Q RR+FCA T ES+ EER+L++ES +GFFD +G + SSSS+LLDGLF Sbjct: 156 PVRQGRRNFCAGTEESVIEERKLRKESAENGFFDDNGNENGSSSSDLLDGLF 207 >emb|CAB45991.1| OBP33pep like protein [Arabidopsis thaliana] gi|7268299|emb|CAB78594.1| OBP33pep like protein [Arabidopsis thaliana] Length = 278 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/52 (61%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -1 Query: 509 PVKQVRRSFCAETSESISEERRLKRESNSSGFFDQSGKDE-SSSSNLLDGLF 357 PV+Q RR+FCA T ES+ EER+L++ES +GFFD +G + SSSS+LLDGLF Sbjct: 168 PVRQGRRNFCAGTEESVIEERKLRKESAENGFFDDNGNENGSSSSDLLDGLF 219 >ref|NP_193287.1| tRNA/rRNA methyltransferase (SpoU) family protein [Arabidopsis thaliana] gi|26449903|dbj|BAC42073.1| OBP33pep like protein [Arabidopsis thaliana] gi|28827336|gb|AAO50512.1| putative OBP33pep protein [Arabidopsis thaliana] gi|332658215|gb|AEE83615.1| tRNA/rRNA methyltransferase (SpoU) family protein [Arabidopsis thaliana] Length = 222 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/52 (61%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -1 Query: 509 PVKQVRRSFCAETSESISEERRLKRESNSSGFFDQSGKDE-SSSSNLLDGLF 357 PV+Q RR+FCA T ES+ EER+L++ES +GFFD +G + SSSS+LLDGLF Sbjct: 168 PVRQGRRNFCAGTEESVIEERKLRKESAENGFFDDNGNENGSSSSDLLDGLF 219