BLASTX nr result
ID: Cephaelis21_contig00035224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035224 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78493.1| hypothetical protein VITISV_037041 [Vitis vinifera] 55 5e-07 >emb|CAN78493.1| hypothetical protein VITISV_037041 [Vitis vinifera] Length = 1048 Score = 55.1 bits (131), Expect(2) = 5e-07 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = -2 Query: 298 VDKFLSPTDFIILEMKEDNDVPLILGRSFLATGDAWF*VKDKTIIFQVNREK 143 VDKFL P DFI+L+M+ED DVPLILGR FLAT +I +V E+ Sbjct: 420 VDKFLFPIDFIVLDMEEDRDVPLILGRPFLATSRTLIDFHQGKLILRVQDEQ 471 Score = 23.5 bits (49), Expect(2) = 5e-07 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -3 Query: 168 LFFKSIEKKIIFHMDNAMKYQGEPPRCCKIDILDLYV 58 L + ++++ F++ AMK+ C I++LD V Sbjct: 463 LILRVQDEQVTFNVFEAMKFPSNVDACFAINVLDRVV 499