BLASTX nr result
ID: Cephaelis21_contig00034978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034978 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603988.1| hypothetical protein MTR_3g117300 [Medicago ... 55 6e-06 >ref|XP_003603988.1| hypothetical protein MTR_3g117300 [Medicago truncatula] gi|355493036|gb|AES74239.1| hypothetical protein MTR_3g117300 [Medicago truncatula] Length = 94 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/62 (40%), Positives = 41/62 (66%) Frame = -1 Query: 215 VWIKFEKLPIFLFQKDVLFALASTVGIPLRLDANTAALRKPSVSRIQVELNLLKDRPDCI 36 VWI+F L + + + +L ALAST+G P+R+D+NT +R+ +R+ VE++L K + Sbjct: 28 VWIRFPGLNLVFYDESILLALASTIGRPIRIDSNTFDVRRGRFARVCVEIDLNKPVVGKV 87 Query: 35 WI 30 WI Sbjct: 88 WI 89