BLASTX nr result
ID: Cephaelis21_contig00034908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034908 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170977.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 91 7e-17 ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 91 7e-17 gb|ADE76650.1| unknown [Picea sitchensis] 91 1e-16 ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 90 2e-16 ref|XP_003563091.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 88 6e-16 >ref|XP_004170977.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like, partial [Cucumis sativus] Length = 137 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 PELGPPVGPSTFFSSKQFEVFDVELLSIQDCKRRTIGFYSDFVC 134 PELGPPVGPSTFFSSKQFEVFDVELLS+QDC+RRTIGFYSD VC Sbjct: 93 PELGPPVGPSTFFSSKQFEVFDVELLSVQDCQRRTIGFYSDIVC 136 >ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Cucumis sativus] Length = 260 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 PELGPPVGPSTFFSSKQFEVFDVELLSIQDCKRRTIGFYSDFVC 134 PELGPPVGPSTFFSSKQFEVFDVELLS+QDC+RRTIGFYSD VC Sbjct: 216 PELGPPVGPSTFFSSKQFEVFDVELLSVQDCQRRTIGFYSDIVC 259 >gb|ADE76650.1| unknown [Picea sitchensis] Length = 352 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +3 Query: 3 PELGPPVGPSTFFSSKQFEVFDVELLSIQDCKRRTIGFYSDFVCE 137 PELGPPVGPSTFFSSKQFEVFDV+LLS+QDC+RRT GFY+DFVC+ Sbjct: 308 PELGPPVGPSTFFSSKQFEVFDVDLLSVQDCRRRTFGFYADFVCD 352 >ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 PELGPPVGPSTFFSSKQFEVFDVELLSIQDCKRRTIGFYSDFVCE 137 PELGPPVGPSTFFSSKQFEVFDVELL+++DC+RRTIGFYSD VCE Sbjct: 214 PELGPPVGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCE 258 >ref|XP_003563091.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 208 Score = 88.2 bits (217), Expect = 6e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 PELGPPVGPSTFFSSKQFEVFDVELLSIQDCKRRTIGFYSDFVC 134 PELGPPVGPSTFFS+KQFEVFDVELLS++DC+RRTIGFYSD VC Sbjct: 164 PELGPPVGPSTFFSAKQFEVFDVELLSVKDCERRTIGFYSDVVC 207