BLASTX nr result
ID: Cephaelis21_contig00034889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034889 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK01137.1|AF331659_1 starch phosphorylase [Ipomoea batatas] 57 2e-06 ref|NP_190281.1| alpha-glucan phosphorylase isozyme H [Arabidops... 55 5e-06 ref|XP_002877534.1| alpha-glucan phosphorylase 2 [Arabidopsis ly... 55 5e-06 gb|AAL10498.1| AT3g46970/F13I12_20 [Arabidopsis thaliana] 55 5e-06 >gb|AAK01137.1|AF331659_1 starch phosphorylase [Ipomoea batatas] Length = 539 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SSIRVLDHNPQKPVVRMANLCVVSSHTVRSVLAVY 106 S+I +LDHNPQKPVVRMANLCV+SSHTV V ++ Sbjct: 290 SAICILDHNPQKPVVRMANLCVISSHTVNGVAQLH 324 >ref|NP_190281.1| alpha-glucan phosphorylase isozyme H [Arabidopsis thaliana] gi|14916634|sp|Q9SD76.1|PHS2_ARATH RecName: Full=Alpha-glucan phosphorylase 2, cytosolic; Short=AtPHS2; AltName: Full=Alpha-glucan phosphorylase, H isozyme; AltName: Full=Starch phosphorylase H gi|6522578|emb|CAB61943.1| starch phosphorylase H (cytosolic form)-like protein [Arabidopsis thaliana] gi|19699065|gb|AAL90900.1| AT3g46970/F13I12_20 [Arabidopsis thaliana] gi|27764912|gb|AAO23577.1| At3g46970/F13I12_20 [Arabidopsis thaliana] gi|332644704|gb|AEE78225.1| alpha-glucan phosphorylase isozyme H [Arabidopsis thaliana] Length = 841 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SSIRVLDHNPQKPVVRMANLCVVSSHTVRSVLAVY 106 SS+ +LD+NPQKPVVRMANLCVVSSHTV V ++ Sbjct: 428 SSLSILDNNPQKPVVRMANLCVVSSHTVNGVAQLH 462 >ref|XP_002877534.1| alpha-glucan phosphorylase 2 [Arabidopsis lyrata subsp. lyrata] gi|297323372|gb|EFH53793.1| alpha-glucan phosphorylase 2 [Arabidopsis lyrata subsp. lyrata] Length = 841 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SSIRVLDHNPQKPVVRMANLCVVSSHTVRSVLAVY 106 SS+ +LD+NPQKPVVRMANLCVVSSHTV V ++ Sbjct: 428 SSLSILDNNPQKPVVRMANLCVVSSHTVNGVAQLH 462 >gb|AAL10498.1| AT3g46970/F13I12_20 [Arabidopsis thaliana] Length = 841 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SSIRVLDHNPQKPVVRMANLCVVSSHTVRSVLAVY 106 SS+ +LD+NPQKPVVRMANLCVVSSHTV V ++ Sbjct: 428 SSLSILDNNPQKPVVRMANLCVVSSHTVNGVAQLH 462