BLASTX nr result
ID: Cephaelis21_contig00034874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034874 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165491.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 66 3e-09 ref|XP_004136748.1| PREDICTED: putative pentatricopeptide repeat... 66 3e-09 ref|XP_002322703.1| predicted protein [Populus trichocarpa] gi|2... 56 4e-06 >ref|XP_004165491.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g52630-like [Cucumis sativus] Length = 598 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +3 Query: 159 PPKIPLSPGSFQENYRIICNLLLSLTRSGPLTRGQALHCHVIKSGIQIIPLVS 317 P + PL+ SF++NYR ICNLLLS TRS L +G LH H++K G+Q IPLVS Sbjct: 11 PSQNPLNQNSFEQNYRQICNLLLSFTRSRSLRQGLQLHAHILKFGLQTIPLVS 63 >ref|XP_004136748.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Cucumis sativus] Length = 598 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +3 Query: 159 PPKIPLSPGSFQENYRIICNLLLSLTRSGPLTRGQALHCHVIKSGIQIIPLVS 317 P + PL+ SF++NYR ICNLLLS TRS L +G LH H++K G+Q IPLVS Sbjct: 11 PSQNPLNQNSFEQNYRQICNLLLSFTRSRSLRQGLQLHAHILKFGLQTIPLVS 63 >ref|XP_002322703.1| predicted protein [Populus trichocarpa] gi|222867333|gb|EEF04464.1| predicted protein [Populus trichocarpa] Length = 627 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +3 Query: 150 PQNPPKIPLSPGSFQENYRIICNLLLSLTRSGPLTRGQALHCHVIKSGIQIIPLV 314 PQN P S ++ Y IC+LLLS TRS L +GQ +H H+IKSG+Q+IPLV Sbjct: 41 PQNSPNRFCS----EKKYGHICDLLLSQTRSRSLLKGQQIHAHIIKSGLQVIPLV 91