BLASTX nr result
ID: Cephaelis21_contig00034765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034765 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35464.3| unnamed protein product [Vitis vinifera] 64 1e-08 gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana] 64 2e-08 ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vi... 63 3e-08 gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri... 63 3e-08 emb|CBI35471.3| unnamed protein product [Vitis vinifera] 63 3e-08 >emb|CBI35464.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 209 YNLRFCPTVCNSCRPICRDVGIYDDPDFTRRLTLGDVPFLVMFRKA 72 Y L FCPTVC+ C+P+C D+GIY ++ RRL L DVPF VMF+KA Sbjct: 181 YKLVFCPTVCDFCKPVCGDIGIYIQNEY-RRLALSDVPFKVMFKKA 225 >gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana] Length = 205 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 209 YNLRFCPTVCNSCRPICRDVGIYDDPDFTRRLTLGDVPFLVMFRKA 72 Y L +CPTVCN C+ IC+D+GI+ D TRRL L DVPF VMF+KA Sbjct: 161 YKLVYCPTVCNFCKVICKDIGIFIQ-DGTRRLALSDVPFKVMFKKA 205 >ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera] Length = 162 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 209 YNLRFCPTVCNSCRPICRDVGIYDDPDFTRRLTLGDVPFLVMFRKA 72 Y L FCPTVC+ C+P+C D+GIY + RRL L DVPF VMF+KA Sbjct: 118 YKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALSDVPFKVMFKKA 162 >gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia] Length = 203 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 209 YNLRFCPTVCNSCRPICRDVGIYDDPDFTRRLTLGDVPFLVMFRKA 72 Y L FCPTVC+ C+P+C D+GIY + RRL L DVPF VMF+KA Sbjct: 159 YKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALSDVPFKVMFKKA 203 >emb|CBI35471.3| unnamed protein product [Vitis vinifera] Length = 2095 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 209 YNLRFCPTVCNSCRPICRDVGIYDDPDFTRRLTLGDVPFLVMFRKA 72 Y L FCPTVC+ C+P+C D+GIY + RRL L DVPF VMF+KA Sbjct: 2051 YKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALSDVPFKVMFKKA 2095