BLASTX nr result
ID: Cephaelis21_contig00034636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034636 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus comm... 113 1e-23 emb|CBI19552.3| unnamed protein product [Vitis vinifera] 106 2e-21 ref|XP_002282546.1| PREDICTED: patatin-T5-like [Vitis vinifera] 106 2e-21 ref|XP_002282481.1| PREDICTED: patatin group A-3-like [Vitis vin... 106 2e-21 emb|CBI19548.3| unnamed protein product [Vitis vinifera] 106 2e-21 >ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis] gi|223550959|gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis] Length = 411 Score = 113 bits (283), Expect = 1e-23 Identities = 52/67 (77%), Positives = 57/67 (85%) Frame = +3 Query: 3 GTSTGGLVTAMLAAPDENNRPLFAAKDIKDFYLDHCPKIFPQESHFLLGSAEKIVKAVSG 182 GTSTGGLVTAML APDENNRPLFAAKDIKDFYL+HCPKIFPQ L +K+VK +SG Sbjct: 65 GTSTGGLVTAMLTAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISG 124 Query: 183 PKYDGKY 203 PKY+GKY Sbjct: 125 PKYNGKY 131 >emb|CBI19552.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 106 bits (265), Expect = 2e-21 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%) Frame = +3 Query: 3 GTSTGGLVTAMLAAPDENN-RPLFAAKDIKDFYLDHCPKIFPQESHFLLGSAEKIVKAVS 179 GTSTGGLVTAML P+EN RPLF+AKDIKDFYLDHCPKIFPQ SH + K+V A+S Sbjct: 117 GTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALS 176 Query: 180 GPKYDGKY 203 GPKYDGKY Sbjct: 177 GPKYDGKY 184 >ref|XP_002282546.1| PREDICTED: patatin-T5-like [Vitis vinifera] Length = 444 Score = 106 bits (265), Expect = 2e-21 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%) Frame = +3 Query: 3 GTSTGGLVTAMLAAPDENN-RPLFAAKDIKDFYLDHCPKIFPQESHFLLGSAEKIVKAVS 179 GTSTGGLVTAML P+EN RPLF+AKDIKDFYLDHCPKIFPQ SH + K+V A+S Sbjct: 63 GTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALS 122 Query: 180 GPKYDGKY 203 GPKYDGKY Sbjct: 123 GPKYDGKY 130 >ref|XP_002282481.1| PREDICTED: patatin group A-3-like [Vitis vinifera] Length = 413 Score = 106 bits (265), Expect = 2e-21 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%) Frame = +3 Query: 3 GTSTGGLVTAMLAAPDENN-RPLFAAKDIKDFYLDHCPKIFPQESHFLLGSAEKIVKAVS 179 GTSTGGLVTAML P+EN RPLF+AKDIKDFYLDHCPKIFPQ SH + K+V A+S Sbjct: 63 GTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALS 122 Query: 180 GPKYDGKY 203 GPKYDGKY Sbjct: 123 GPKYDGKY 130 >emb|CBI19548.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 106 bits (265), Expect = 2e-21 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%) Frame = +3 Query: 3 GTSTGGLVTAMLAAPDENN-RPLFAAKDIKDFYLDHCPKIFPQESHFLLGSAEKIVKAVS 179 GTSTGGLVTAML P+EN RPLF+AKDIKDFYLDHCPKIFPQ SH + K+V A+S Sbjct: 63 GTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALS 122 Query: 180 GPKYDGKY 203 GPKYDGKY Sbjct: 123 GPKYDGKY 130