BLASTX nr result
ID: Cephaelis21_contig00034595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034595 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas gi|56... 82 6e-14 ref|NP_178533.2| 3-oxoacyl-[acyl-carrier-protein] synthase [Arab... 82 6e-14 gb|AAD25826.1| 3-oxoacyl carrier protein synthase [Arabidopsis t... 82 6e-14 ref|XP_002302852.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002277197.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 79 4e-13 >pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas gi|56966611|pdb|1W0I|B Chain B, Arabidopsis Thaliana Mitochondrial Kas gi|126030848|pdb|2IX4|A Chain A, Arabidopsis Thaliana Mitochondrial Beta-Ketoacyl Acp Synthase Hexanoic Acid Complex gi|126030849|pdb|2IX4|B Chain B, Arabidopsis Thaliana Mitochondrial Beta-Ketoacyl Acp Synthase Hexanoic Acid Complex Length = 431 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +1 Query: 55 CSFIKVIFLLVMKRLRRLSPFFIPRILINMASGHVSMTYGFQGPNHAAVT 204 C ++ L+ KRLRRLSPFFIP+IL+NMASGHVSM YGFQGPNHAAVT Sbjct: 128 CDIVEAAQLICEKRLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVT 177 >ref|NP_178533.2| 3-oxoacyl-[acyl-carrier-protein] synthase [Arabidopsis thaliana] gi|62286891|sp|Q8L3X9.1|KASM_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial; AltName: Full=Beta-ketoacyl-ACP synthase; AltName: Full=mtKAS; Flags: Precursor gi|20373025|dbj|BAB91181.1| 3-ketoacyl-acyl carrier protein synthase [Arabidopsis thaliana] gi|20466243|gb|AAM20439.1| 3-oxoacyl carrier protein synthase [Arabidopsis thaliana] gi|22136308|gb|AAM91232.1| 3-oxoacyl carrier protein synthase [Arabidopsis thaliana] gi|330250750|gb|AEC05844.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Arabidopsis thaliana] Length = 461 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +1 Query: 55 CSFIKVIFLLVMKRLRRLSPFFIPRILINMASGHVSMTYGFQGPNHAAVT 204 C ++ L+ KRLRRLSPFFIP+IL+NMASGHVSM YGFQGPNHAAVT Sbjct: 158 CDIVEAAQLICEKRLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVT 207 >gb|AAD25826.1| 3-oxoacyl carrier protein synthase [Arabidopsis thaliana] Length = 442 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +1 Query: 55 CSFIKVIFLLVMKRLRRLSPFFIPRILINMASGHVSMTYGFQGPNHAAVT 204 C ++ L+ KRLRRLSPFFIP+IL+NMASGHVSM YGFQGPNHAAVT Sbjct: 139 CDIVEAAQLICEKRLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVT 188 >ref|XP_002302852.1| predicted protein [Populus trichocarpa] gi|222844578|gb|EEE82125.1| predicted protein [Populus trichocarpa] Length = 415 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 79 LLVMKRLRRLSPFFIPRILINMASGHVSMTYGFQGPNHAAVT 204 L+ KRLRRLSPFFIPRILINMASGHVSM YGFQGPNHAAVT Sbjct: 120 LICEKRLRRLSPFFIPRILINMASGHVSMKYGFQGPNHAAVT 161 >ref|XP_002277197.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial [Vitis vinifera] gi|297739239|emb|CBI28890.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 79 LLVMKRLRRLSPFFIPRILINMASGHVSMTYGFQGPNHAAVT 204 ++ KRLRRLSPFFIPRILINMASGHVSM YGFQGPNHAAVT Sbjct: 167 MICEKRLRRLSPFFIPRILINMASGHVSMRYGFQGPNHAAVT 208