BLASTX nr result
ID: Cephaelis21_contig00033757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033757 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524769.1| pentatricopeptide repeat-containing protein,... 116 2e-24 ref|NP_180636.1| pentatricopeptide repeat-containing protein [Ar... 114 1e-23 ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 113 2e-23 ref|XP_003553441.1| PREDICTED: pentatricopeptide repeat-containi... 112 3e-23 ref|XP_002879279.1| pentatricopeptide repeat-containing protein ... 112 3e-23 >ref|XP_002524769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535953|gb|EEF37612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 509 Score = 116 bits (291), Expect = 2e-24 Identities = 54/82 (65%), Positives = 66/82 (80%) Frame = +1 Query: 1 YRPWLNVLLICLYANEDLLEAMEISISKAFENNTVVKTTAIMRCIASSYFRQNEVDKLSD 180 YRPWLNVLLI +YA ++LLEAME I +AF++ T + T IMR I +SYFR N VD+L+D Sbjct: 361 YRPWLNVLLIKVYAQQNLLEAMENKIDEAFKHETTITTVGIMRTIIASYFRCNAVDRLAD 420 Query: 181 FVKRAEFAGWKICRCLYHCKMV 246 FVKRAE +GW+ICR LYHCKMV Sbjct: 421 FVKRAECSGWRICRSLYHCKMV 442 >ref|NP_180636.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75219588|sp|O49343.1|PP177_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g30780 gi|2880055|gb|AAC02749.1| hypothetical protein [Arabidopsis thaliana] gi|110736845|dbj|BAF00380.1| hypothetical protein [Arabidopsis thaliana] gi|330253346|gb|AEC08440.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 452 Score = 114 bits (284), Expect = 1e-23 Identities = 53/82 (64%), Positives = 65/82 (79%) Frame = +1 Query: 1 YRPWLNVLLICLYANEDLLEAMEISISKAFENNTVVKTTAIMRCIASSYFRQNEVDKLSD 180 Y PWLNVLLI LYA ED +EAME I++AFE T V ++IMR I ++YFR NEVD L++ Sbjct: 313 YLPWLNVLLIRLYAQEDFVEAMESKINEAFEQKTCVNKSSIMRAIIAAYFRCNEVDNLAN 372 Query: 181 FVKRAEFAGWKICRCLYHCKMV 246 FVKRAE AGWK+CR LYHCK++ Sbjct: 373 FVKRAESAGWKLCRSLYHCKIM 394 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 113 bits (282), Expect = 2e-23 Identities = 53/82 (64%), Positives = 65/82 (79%) Frame = +1 Query: 1 YRPWLNVLLICLYANEDLLEAMEISISKAFENNTVVKTTAIMRCIASSYFRQNEVDKLSD 180 YRPWLNV+LI +YA ED +E ME SI++AFE+ T VKT +MR I ++YFR N VD+L++ Sbjct: 346 YRPWLNVMLIRVYAQEDWVEEMENSINEAFEHKTSVKTMRVMRSIIATYFRCNAVDRLAN 405 Query: 181 FVKRAEFAGWKICRCLYHCKMV 246 FVKRAE GW ICR LYHCKMV Sbjct: 406 FVKRAECGGWHICRSLYHCKMV 427 >ref|XP_003553441.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Glycine max] Length = 504 Score = 112 bits (280), Expect = 3e-23 Identities = 50/82 (60%), Positives = 64/82 (78%) Frame = +1 Query: 1 YRPWLNVLLICLYANEDLLEAMEISISKAFENNTVVKTTAIMRCIASSYFRQNEVDKLSD 180 YRPWLNVLLI LYA ED LE ME +I++AFE+ T + T I+RCI ++Y+R N V+KL + Sbjct: 358 YRPWLNVLLIKLYAKEDWLEKMENAINEAFEHGTSITTKGILRCIVATYYRYNAVEKLEN 417 Query: 181 FVKRAEFAGWKICRCLYHCKMV 246 FV+RAE +GW ICR YHCK+V Sbjct: 418 FVRRAEISGWSICRSAYHCKLV 439 >ref|XP_002879279.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325118|gb|EFH55538.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 452 Score = 112 bits (280), Expect = 3e-23 Identities = 52/82 (63%), Positives = 66/82 (80%) Frame = +1 Query: 1 YRPWLNVLLICLYANEDLLEAMEISISKAFENNTVVKTTAIMRCIASSYFRQNEVDKLSD 180 Y PWLN LLI LYA ED++EAME I++AFE+ T V ++IMR I ++YFR NEVD L++ Sbjct: 313 YLPWLNGLLIRLYAQEDIVEAMESKINEAFEHKTCVNKSSIMRAIIAAYFRFNEVDNLAN 372 Query: 181 FVKRAEFAGWKICRCLYHCKMV 246 FVKRAE AGWK+CR LYHCK++ Sbjct: 373 FVKRAESAGWKLCRSLYHCKIM 394