BLASTX nr result
ID: Cephaelis21_contig00033558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033558 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Ca... 145 4e-33 gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Ca... 144 6e-33 gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Ca... 143 1e-32 gb|ACQ57188.1| acyl acyl-carrier-protein thioesterase type B [Ca... 136 2e-30 ref|XP_002515564.1| palmitoyl-acyl carrier protein thioesterase ... 134 8e-30 >gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 145 bits (365), Expect = 4e-33 Identities = 71/89 (79%), Positives = 77/89 (86%) Frame = +3 Query: 3 SAPLSILESHELASMTLEYRRECRRDSVVQSLTSVSGNVVGDLANPGYVECQHLLRLEGG 182 SAPL ILESHEL MTLEYRREC RDSV+QSLT+VSG VG L +PGYVECQHLLRLEGG Sbjct: 346 SAPLPILESHELCGMTLEYRRECGRDSVLQSLTTVSGGGVGSLVDPGYVECQHLLRLEGG 405 Query: 183 AEIVKGRTEWRPKCATRIGSLGELPAESA 269 AEIVKGRTEWRPK A +G+LG LPAES+ Sbjct: 406 AEIVKGRTEWRPKYANCVGTLGSLPAESS 434 >gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 144 bits (364), Expect = 6e-33 Identities = 71/89 (79%), Positives = 77/89 (86%) Frame = +3 Query: 3 SAPLSILESHELASMTLEYRRECRRDSVVQSLTSVSGNVVGDLANPGYVECQHLLRLEGG 182 SAPL ILESHEL MTLEYRREC RDSV+QSLT+VSG VG L +PGYVECQHLLRLEGG Sbjct: 346 SAPLPILESHELCGMTLEYRRECGRDSVLQSLTTVSGGGVGSLVDPGYVECQHLLRLEGG 405 Query: 183 AEIVKGRTEWRPKCATRIGSLGELPAESA 269 AEIVKGRTEWRPK A +G+LG LPAES+ Sbjct: 406 AEIVKGRTEWRPKYANCLGTLGSLPAESS 434 >gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 420 Score = 143 bits (361), Expect = 1e-32 Identities = 70/89 (78%), Positives = 76/89 (85%) Frame = +3 Query: 3 SAPLSILESHELASMTLEYRRECRRDSVVQSLTSVSGNVVGDLANPGYVECQHLLRLEGG 182 SAPL ILESHEL MTLEYRREC RDSV+QSLT+VSG VG L +PGYVECQHLLRLEGG Sbjct: 332 SAPLPILESHELCGMTLEYRRECGRDSVLQSLTTVSGGGVGSLVDPGYVECQHLLRLEGG 391 Query: 183 AEIVKGRTEWRPKCATRIGSLGELPAESA 269 AEIVKGRTEWRPK A +G+LG LP ES+ Sbjct: 392 AEIVKGRTEWRPKYANCVGTLGSLPTESS 420 >gb|ACQ57188.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 436 Score = 136 bits (343), Expect = 2e-30 Identities = 67/91 (73%), Positives = 74/91 (81%) Frame = +3 Query: 3 SAPLSILESHELASMTLEYRRECRRDSVVQSLTSVSGNVVGDLANPGYVECQHLLRLEGG 182 SAPL ILESHEL MTLEYRREC RDSV+QSLT+VSG VG L +PGYVECQHLLRLEGG Sbjct: 346 SAPLPILESHELCGMTLEYRRECGRDSVLQSLTTVSGGGVGSLVDPGYVECQHLLRLEGG 405 Query: 183 AEIVKGRTEWRPKCATRIGSLGELPAESA*C 275 AEIVKGRTEWRPK A +G+LG ++ C Sbjct: 406 AEIVKGRTEWRPKYANCVGTLGYFQQKAVNC 436 >ref|XP_002515564.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] gi|157417724|gb|ABV54795.1| acyl-ACP thioesterase [Ricinus communis] gi|223545508|gb|EEF47013.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] Length = 419 Score = 134 bits (337), Expect = 8e-30 Identities = 63/89 (70%), Positives = 77/89 (86%) Frame = +3 Query: 3 SAPLSILESHELASMTLEYRRECRRDSVVQSLTSVSGNVVGDLANPGYVECQHLLRLEGG 182 SAPL ILESHEL+++TLEYRREC RDSV+QSLT+VSGN +G+L N G +ECQHLLRLE G Sbjct: 331 SAPLPILESHELSAITLEYRRECGRDSVLQSLTAVSGNGIGNLGNAGDIECQHLLRLEDG 390 Query: 183 AEIVKGRTEWRPKCATRIGSLGELPAESA 269 AEIV+GRTEWRPK ++ G +G++P ESA Sbjct: 391 AEIVRGRTEWRPKYSSNFGIMGQIPVESA 419