BLASTX nr result
ID: Cephaelis21_contig00032345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032345 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863581.1| FAD-binding domain-containing protein [Arabi... 55 8e-06 ref|NP_199253.1| FAD-binding and BBE domain-containing protein [... 55 8e-06 >ref|XP_002863581.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309416|gb|EFH39840.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 540 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = -3 Query: 235 KSDFVKDPIPESGIEVLLHKLL--EVPLGSGEMEWTFCGGGIMDKIPPSEIAFPHR-GYL 65 KSDFVK PIPESG++ + KLL ++PL M W GG+M KIP S+I FPHR G L Sbjct: 384 KSDFVKTPIPESGLQGIFKKLLKEDIPL----MIWN-PYGGMMAKIPESQIPFPHRKGVL 438 Query: 64 FIV 56 F V Sbjct: 439 FKV 441 >ref|NP_199253.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] gi|10176895|dbj|BAB10125.1| berberine bridge enzyme [Arabidopsis thaliana] gi|18176302|gb|AAL60019.1| putative berberine bridge enzyme [Arabidopsis thaliana] gi|332007722|gb|AED95105.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] Length = 537 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = -3 Query: 235 KSDFVKDPIPESGIEVLLHKLL--EVPLGSGEMEWTFCGGGIMDKIPPSEIAFPHR-GYL 65 KSDFVK PIPESG++ + KLL ++PL M W GG+M KIP S+I FPHR G L Sbjct: 381 KSDFVKTPIPESGLQGIFKKLLKEDIPL----MIWN-PYGGMMAKIPESQIPFPHRKGVL 435 Query: 64 FIV 56 F V Sbjct: 436 FKV 438