BLASTX nr result
ID: Cephaelis21_contig00032325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032325 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] 56 3e-06 >emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] Length = 188 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = +3 Query: 6 WGRIIINLCKCMRI---YMQAEGMATSYPHNIFSFAISILLNFLVLKYQNQGKSPFQTHP 176 WG I+ C Y+ ++ + H + +F + +L+ FL LKY + +PF+THP Sbjct: 9 WGTILRQAHHCFTFTINYLLQGRLSPNSCHAVLAFILPLLVAFLALKYVEKVATPFETHP 68 Query: 177 KTVFLGILSLLLYCFSYDYQ 236 KT+ I SLL+YC +Y Q Sbjct: 69 KTMQFAIGSLLVYCLAYGTQ 88