BLASTX nr result
ID: Cephaelis21_contig00032324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032324 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520697.1| pax transcription activation domain interact... 58 9e-07 >ref|XP_002520697.1| pax transcription activation domain interacting protein, putative [Ricinus communis] gi|223540082|gb|EEF41659.1| pax transcription activation domain interacting protein, putative [Ricinus communis] Length = 921 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = -2 Query: 306 FDWDEKQSSEGHSIKVSDEEFDVRSLGQSPDKDESETNVPDTFDVGFDTQMAAEAIEALT 127 F+ + + E S+K S+E+ LG+ D +E N PDTFDVGF TQMAAEA+EAL+ Sbjct: 263 FEQASETNFENVSVKNSNEQSHEVQLGRDIDAYNTEENAPDTFDVGFGTQMAAEAMEALS 322 Query: 126 Y 124 Y Sbjct: 323 Y 323