BLASTX nr result
ID: Cephaelis21_contig00032317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032317 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synth... 51 4e-06 >ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] Length = 516 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 139 AEGSAPSTIYPKDKWEPFCKKKVVMRVGYVGSDYR 243 A S S P +KWEPF KKKVVMRVGYVG+D+R Sbjct: 55 ASTSTQSLPTPSEKWEPFLKKKVVMRVGYVGTDFR 89 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 332 GLQMQRDEHAL 364 GLQMQRDEH L Sbjct: 90 GLQMQRDEHRL 100