BLASTX nr result
ID: Cephaelis21_contig00032211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032211 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331928.1| predicted protein [Populus trichocarpa] gi|2... 82 2e-22 emb|CBI26393.3| unnamed protein product [Vitis vinifera] 80 6e-22 ref|XP_002267038.2| PREDICTED: uncharacterized protein LOC100261... 80 6e-22 ref|XP_003548277.1| PREDICTED: uncharacterized protein LOC100804... 80 1e-21 ref|XP_003619796.1| hypothetical protein MTR_6g069050 [Medicago ... 77 1e-20 >ref|XP_002331928.1| predicted protein [Populus trichocarpa] gi|222874600|gb|EEF11731.1| predicted protein [Populus trichocarpa] Length = 321 Score = 81.6 bits (200), Expect(2) = 2e-22 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 2 RYVQAPLAYPRERKRRMNGGEDWLPFCIYREGKLAERLSPC 124 RY+QAPLAYPRERKRRMNGGE WLPFC+Y GK A+RLSPC Sbjct: 252 RYIQAPLAYPRERKRRMNGGETWLPFCVYSGGKFADRLSPC 292 Score = 49.3 bits (116), Expect(2) = 2e-22 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 174 WSDYYDHNPRVPDVTQLAPWVARFYAR 254 WSDYY +PR P VT+LAPWVARFY R Sbjct: 294 WSDYYAAHPRAPHVTELAPWVARFYNR 320 >emb|CBI26393.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 79.7 bits (195), Expect(2) = 6e-22 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 2 RYVQAPLAYPRERKRRMNGGEDWLPFCIYREGKLAERLSPC 124 RYVQAPLAYPRERKRRMNGGEDWLPFCIY +GK A++L C Sbjct: 343 RYVQAPLAYPRERKRRMNGGEDWLPFCIYCDGKFADKLMAC 383 Score = 49.3 bits (116), Expect(2) = 6e-22 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 174 WSDYYDHNPRVPDVTQLAPWVARFYAR 254 WS+YY NPR P TQLAPWVARFY R Sbjct: 385 WSEYYSTNPRTPHNTQLAPWVARFYKR 411 >ref|XP_002267038.2| PREDICTED: uncharacterized protein LOC100261372 [Vitis vinifera] Length = 330 Score = 79.7 bits (195), Expect(2) = 6e-22 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 2 RYVQAPLAYPRERKRRMNGGEDWLPFCIYREGKLAERLSPC 124 RYVQAPLAYPRERKRRMNGGEDWLPFCIY +GK A++L C Sbjct: 261 RYVQAPLAYPRERKRRMNGGEDWLPFCIYCDGKFADKLMAC 301 Score = 49.3 bits (116), Expect(2) = 6e-22 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 174 WSDYYDHNPRVPDVTQLAPWVARFYAR 254 WS+YY NPR P TQLAPWVARFY R Sbjct: 303 WSEYYSTNPRTPHNTQLAPWVARFYKR 329 >ref|XP_003548277.1| PREDICTED: uncharacterized protein LOC100804790 [Glycine max] Length = 385 Score = 80.5 bits (197), Expect(2) = 1e-21 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 2 RYVQAPLAYPRERKRRMNGGEDWLPFCIYREGKLAERLSPC 124 RYVQAPLAYPRERKRRMNGGE+WLPFC+Y + K A+RL+PC Sbjct: 311 RYVQAPLAYPRERKRRMNGGENWLPFCLYADNKFADRLNPC 351 Score = 47.8 bits (112), Expect(2) = 1e-21 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = +3 Query: 174 WSDYYDHNPRVPDVTQLAPWVARFY 248 WSDYY NPR P T+LAPWVARFY Sbjct: 353 WSDYYSANPRTPHNTKLAPWVARFY 377 >ref|XP_003619796.1| hypothetical protein MTR_6g069050 [Medicago truncatula] gi|355494811|gb|AES76014.1| hypothetical protein MTR_6g069050 [Medicago truncatula] Length = 382 Score = 77.0 bits (188), Expect(2) = 1e-20 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 2 RYVQAPLAYPRERKRRMNGGEDWLPFCIYREGKLAERLSPC 124 RYVQAPLAYPRERKRRMNGGE+WLPFC+Y + K ++L+PC Sbjct: 308 RYVQAPLAYPRERKRRMNGGENWLPFCLYADKKFTDKLNPC 348 Score = 47.8 bits (112), Expect(2) = 1e-20 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +3 Query: 174 WSDYYDHNPRVPDVTQLAPWVARFYAR 254 WSDYY NPR P T+LAPWVARFY + Sbjct: 350 WSDYYSVNPRTPHDTKLAPWVARFYKK 376