BLASTX nr result
ID: Cephaelis21_contig00032191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032191 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28417.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002272021.1| PREDICTED: uncharacterized protein LOC100249... 57 2e-06 >emb|CBI28417.3| unnamed protein product [Vitis vinifera] Length = 1255 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 1 ILMQHKDFPDAGKLMLTAVMLGSVNVAAVVYEVPFLME 114 ILMQHKDFPDAGKLMLTAVM+GSV + YE P ME Sbjct: 1218 ILMQHKDFPDAGKLMLTAVMMGSVEIDVRSYEGPSPME 1255 >ref|XP_002272021.1| PREDICTED: uncharacterized protein LOC100249432 isoform 1 [Vitis vinifera] Length = 1330 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 1 ILMQHKDFPDAGKLMLTAVMLGSVNVAAVVYEVPFLME 114 ILMQHKDFPDAGKLMLTAVM+GSV + YE P ME Sbjct: 1293 ILMQHKDFPDAGKLMLTAVMMGSVEIDVRSYEGPSPME 1330