BLASTX nr result
ID: Cephaelis21_contig00032188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032188 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266564.2| PREDICTED: uncharacterized protein LOC100266... 72 8e-11 ref|XP_002522574.1| catalytic, putative [Ricinus communis] gi|22... 66 5e-09 emb|CAN71578.1| hypothetical protein VITISV_003228 [Vitis vinifera] 65 8e-09 >ref|XP_002266564.2| PREDICTED: uncharacterized protein LOC100266871 [Vitis vinifera] Length = 460 Score = 71.6 bits (174), Expect = 8e-11 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = +2 Query: 422 FSGIKKIWKHQNLRALAMDTAQGNVISPKRIMNFKDEPDHLLVLVHGILA 571 FSGI WKH++LRA AM T QGN SP+ M+ K EPDHLLVLVHGILA Sbjct: 61 FSGINSTWKHKSLRAQAMSTTQGNAASPRGFMHGKYEPDHLLVLVHGILA 110 >ref|XP_002522574.1| catalytic, putative [Ricinus communis] gi|223538265|gb|EEF39874.1| catalytic, putative [Ricinus communis] Length = 459 Score = 65.9 bits (159), Expect = 5e-09 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +2 Query: 401 HGSGFIGFSGIKKIWKHQNLRALAMDTA-QGNVISPKRIMNFKDEPDHLLVLVHGILA 571 HG F FSG+ W+HQ+ RA AM+TA +GN S K ++N +EPDHLLVLVHGILA Sbjct: 52 HGLNF--FSGVNSNWRHQDFRAQAMNTAIRGNFASSKGVVNGNNEPDHLLVLVHGILA 107 >emb|CAN71578.1| hypothetical protein VITISV_003228 [Vitis vinifera] Length = 258 Score = 65.1 bits (157), Expect = 8e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +2 Query: 443 WKHQNLRALAMDTAQGNVISPKRIMNFKDEPDHLLVLVHGILA 571 WKH++LRA AM T QGN SP+ M+ K EPDHLLVLVHGILA Sbjct: 61 WKHKSLRAQAMSTTQGNAASPRGFMHGKHEPDHLLVLVHGILA 103