BLASTX nr result
ID: Cephaelis21_contig00032150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032150 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778... 106 2e-21 ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycin... 106 2e-21 ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810... 105 3e-21 ref|XP_002305745.1| predicted protein [Populus trichocarpa] gi|1... 105 3e-21 ref|XP_002522583.1| conserved hypothetical protein [Ricinus comm... 105 4e-21 >ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max] Length = 181 Score = 106 bits (264), Expect = 2e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -2 Query: 160 AAQLSRYESQKRRDWNTFGQYLRNQRPPVQLSQCNFNHVLDFLRYLDQFGKTK 2 AA LSRYESQKRRDWNTFGQYL+NQ PPV LSQCNFNHVL+FLRYLDQFGKTK Sbjct: 28 AAPLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTK 80 >ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max] gi|255627477|gb|ACU14083.1| unknown [Glycine max] Length = 181 Score = 106 bits (264), Expect = 2e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -2 Query: 160 AAQLSRYESQKRRDWNTFGQYLRNQRPPVQLSQCNFNHVLDFLRYLDQFGKTK 2 AA LSRYESQKRRDWNTFGQYL+NQ PPV LSQCNFNHVL+FLRYLDQFGKTK Sbjct: 28 AAPLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTK 80 >ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810655 [Glycine max] Length = 167 Score = 105 bits (263), Expect = 3e-21 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 151 LSRYESQKRRDWNTFGQYLRNQRPPVQLSQCNFNHVLDFLRYLDQFGKTK 2 LSRYESQKRRDWNTFGQYLRNQ PPV LSQCNFNHVLDFLRYLDQFGKTK Sbjct: 17 LSRYESQKRRDWNTFGQYLRNQSPPVPLSQCNFNHVLDFLRYLDQFGKTK 66 >ref|XP_002305745.1| predicted protein [Populus trichocarpa] gi|118483353|gb|ABK93578.1| unknown [Populus trichocarpa] gi|222848709|gb|EEE86256.1| predicted protein [Populus trichocarpa] Length = 177 Score = 105 bits (263), Expect = 3e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -2 Query: 160 AAQLSRYESQKRRDWNTFGQYLRNQRPPVQLSQCNFNHVLDFLRYLDQFGKTK 2 +A LSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLDFLRYLDQFGKTK Sbjct: 26 SAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTK 78 >ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis] gi|223538274|gb|EEF39883.1| conserved hypothetical protein [Ricinus communis] Length = 180 Score = 105 bits (262), Expect = 4e-21 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -2 Query: 157 AQLSRYESQKRRDWNTFGQYLRNQRPPVQLSQCNFNHVLDFLRYLDQFGKTK 2 A LSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLDFLRYLDQFGKTK Sbjct: 28 APLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTK 79