BLASTX nr result
ID: Cephaelis21_contig00032126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032126 (624 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511562.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_002324205.1| predicted protein [Populus trichocarpa] gi|2... 63 5e-08 ref|XP_004154975.1| PREDICTED: uncharacterized protein LOC101228... 60 3e-07 ref|XP_004138163.1| PREDICTED: uncharacterized protein LOC101220... 60 3e-07 ref|XP_002443931.1| hypothetical protein SORBIDRAFT_07g004570 [S... 57 4e-06 >ref|XP_002511562.1| conserved hypothetical protein [Ricinus communis] gi|223550677|gb|EEF52164.1| conserved hypothetical protein [Ricinus communis] Length = 314 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -3 Query: 298 RIRGFIFPTALVQAIVYELWYVEEYDVLALALDGKMKAHEFQLGCSST 155 +IRGF+ A+V ELWYVEEYDVLALALDG+MK +FQLGC T Sbjct: 274 QIRGFV-------AVVSELWYVEEYDVLALALDGRMKVRKFQLGCKRT 314 >ref|XP_002324205.1| predicted protein [Populus trichocarpa] gi|222865639|gb|EEF02770.1| predicted protein [Populus trichocarpa] Length = 249 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -3 Query: 298 RIRGFIFPTALVQAIVYELWYVEEYDVLALALDGKMKAHEFQLGCSST 155 +IRGF +A+V ELWYVEEYDVLALALDG+MK F+LGCS T Sbjct: 209 KIRGF-------EAVVSELWYVEEYDVLALALDGRMKVSRFKLGCSRT 249 >ref|XP_004154975.1| PREDICTED: uncharacterized protein LOC101228237 [Cucumis sativus] Length = 308 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 301 RRIRGFIFPTALVQAIVYELWYVEEYDVLALALDGKMKAHEFQLGCSST 155 ++IRGF +A+V ELWYVEEYDVLALAL+G+MK +F LGC S+ Sbjct: 267 KQIRGF-------EAVVSELWYVEEYDVLALALNGRMKVRKFPLGCDSS 308 >ref|XP_004138163.1| PREDICTED: uncharacterized protein LOC101220816 [Cucumis sativus] Length = 308 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 301 RRIRGFIFPTALVQAIVYELWYVEEYDVLALALDGKMKAHEFQLGCSST 155 ++IRGF +A+V ELWYVEEYDVLALAL+G+MK +F LGC S+ Sbjct: 267 KQIRGF-------EAVVSELWYVEEYDVLALALNGRMKVRKFPLGCDSS 308 >ref|XP_002443931.1| hypothetical protein SORBIDRAFT_07g004570 [Sorghum bicolor] gi|241940281|gb|EES13426.1| hypothetical protein SORBIDRAFT_07g004570 [Sorghum bicolor] Length = 333 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -3 Query: 298 RIRGFIFPTALVQAIVYELWYVEEYDVLALALDGKMKAHEFQLGCS 161 +IRGF QA V ELWYVEEYDVLALAL+GKMK LGC+ Sbjct: 291 KIRGF-------QATVSELWYVEEYDVLALALNGKMKVRRLHLGCN 329