BLASTX nr result
ID: Cephaelis21_contig00031997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031997 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315542.1| predicted protein [Populus trichocarpa] gi|2... 103 1e-20 ref|XP_002516830.1| conserved hypothetical protein [Ricinus comm... 103 1e-20 ref|XP_002277209.2| PREDICTED: uncharacterized protein LOC100264... 99 3e-19 ref|XP_002312376.1| predicted protein [Populus trichocarpa] gi|2... 99 4e-19 ref|XP_003542907.1| PREDICTED: uncharacterized protein LOC100819... 94 2e-17 >ref|XP_002315542.1| predicted protein [Populus trichocarpa] gi|222864582|gb|EEF01713.1| predicted protein [Populus trichocarpa] Length = 186 Score = 103 bits (258), Expect = 1e-20 Identities = 49/66 (74%), Positives = 54/66 (81%) Frame = +1 Query: 1 FLSLIVFCALSLLDSNTVKCLYPSFESTQKALLMALPPVIGSVAAAVFAVFPGKRHGIGY 180 F SLIVF LSLLDSNTVKC YPSFEST+K LLM LPP IG+V+ VF +FP KRHGIGY Sbjct: 118 FFSLIVFSVLSLLDSNTVKCFYPSFESTEKVLLMVLPPAIGAVSGTVFMLFPNKRHGIGY 177 Query: 181 PSTSSS 198 PS+ SS Sbjct: 178 PSSDSS 183 >ref|XP_002516830.1| conserved hypothetical protein [Ricinus communis] gi|223543918|gb|EEF45444.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 103 bits (257), Expect = 1e-20 Identities = 48/67 (71%), Positives = 54/67 (80%) Frame = +1 Query: 1 FLSLIVFCALSLLDSNTVKCLYPSFESTQKALLMALPPVIGSVAAAVFAVFPGKRHGIGY 180 F SLIVF LSLLDSNTV C YPSFEST+K LLM LPPVIG+++ VF VFP KRHG+GY Sbjct: 121 FFSLIVFAVLSLLDSNTVDCFYPSFESTEKTLLMVLPPVIGAISGTVFMVFPNKRHGVGY 180 Query: 181 PSTSSSS 201 PS+ S S Sbjct: 181 PSSDSPS 187 >ref|XP_002277209.2| PREDICTED: uncharacterized protein LOC100264790 [Vitis vinifera] gi|297736946|emb|CBI26147.3| unnamed protein product [Vitis vinifera] Length = 166 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/66 (68%), Positives = 55/66 (83%) Frame = +1 Query: 1 FLSLIVFCALSLLDSNTVKCLYPSFESTQKALLMALPPVIGSVAAAVFAVFPGKRHGIGY 180 FLSL VF ++LLDSNTV C YPSFEST+K LLM LPPVIG++++ VF VFP KRHGIGY Sbjct: 98 FLSLTVFAVVALLDSNTVDCFYPSFESTEKLLLMVLPPVIGAISSTVFMVFPNKRHGIGY 157 Query: 181 PSTSSS 198 P++ +S Sbjct: 158 PASQTS 163 >ref|XP_002312376.1| predicted protein [Populus trichocarpa] gi|222852196|gb|EEE89743.1| predicted protein [Populus trichocarpa] Length = 188 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/66 (71%), Positives = 52/66 (78%) Frame = +1 Query: 1 FLSLIVFCALSLLDSNTVKCLYPSFESTQKALLMALPPVIGSVAAAVFAVFPGKRHGIGY 180 F SLIVF LSLLD NTVKC PSFEST+K LLM LPP IG+V+ VF +FP KRHGIGY Sbjct: 119 FFSLIVFAVLSLLDRNTVKCFNPSFESTEKVLLMVLPPAIGAVSGTVFMLFPNKRHGIGY 178 Query: 181 PSTSSS 198 PS+ SS Sbjct: 179 PSSDSS 184 >ref|XP_003542907.1| PREDICTED: uncharacterized protein LOC100819509 [Glycine max] Length = 204 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/67 (59%), Positives = 53/67 (79%) Frame = +1 Query: 1 FLSLIVFCALSLLDSNTVKCLYPSFESTQKALLMALPPVIGSVAAAVFAVFPGKRHGIGY 180 F SL+VF L LLD+NTV+C YP+FES +K L+ +PPVIG+VA+ VF +FP RHGIGY Sbjct: 130 FFSLVVFAVLGLLDTNTVRCFYPAFESAEKILMQVVPPVIGAVASTVFVMFPNNRHGIGY 189 Query: 181 PSTSSSS 201 P++S S+ Sbjct: 190 PTSSDSN 196