BLASTX nr result
ID: Cephaelis21_contig00031979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031979 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, p... 63 3e-08 >ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] gi|223535733|gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] Length = 443 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 209 FDCKGFSFVCASLSVAVSFCYACMLKPNPSSKNLEVDEENVESPLLS 69 FDCKGFS + ASL + V+FCYACMLKP +KNL EE++E+PL++ Sbjct: 398 FDCKGFSIIVASLCMMVAFCYACMLKPEQETKNL---EEDIEAPLIT 441