BLASTX nr result
ID: Cephaelis21_contig00031856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031856 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI17229.1| hypothetical protein [uncultured alpha proteobact... 91 1e-16 ref|YP_005415589.1| hypothetical protein RSPPHO_03280, partial [... 82 6e-14 ref|YP_005415583.1| hypothetical protein RSPPHO_03274, partial [... 75 6e-13 emb|CCG06598.1| Putative uncharacterized protein, partial [Rhodo... 75 6e-13 ref|YP_005415588.1| hypothetical protein RSPPHO_03279 [Rhodospir... 75 4e-12 >gb|ADI17229.1| hypothetical protein [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 90.9 bits (224), Expect = 1e-16 Identities = 50/88 (56%), Positives = 53/88 (60%) Frame = +1 Query: 4 VPIDYAFXXXXXXXXXXXXXXXXXNPWTFGESVFHTHYRYSCQHSHF*YLQQASQLTLTG 183 +PIDY F NPW +GESV HT RYSCQHSHF YLQ SQ T TG Sbjct: 18 IPIDYGFRPRLRGRLTLGGLTLPRNPWAYGESVSHTLCRYSCQHSHFRYLQHPSQDTFTG 77 Query: 184 LQNAPLPHHPKVIPVASVYGLSPVTSSA 267 L+NAPLP K ASVYGLSP TSSA Sbjct: 78 LRNAPLP-CVKDTSSASVYGLSPDTSSA 104 >ref|YP_005415589.1| hypothetical protein RSPPHO_03280, partial [Rhodospirillum photometricum DSM 122] gi|378401503|emb|CCG06619.1| unnamed protein product, partial [Rhodospirillum photometricum DSM 122] Length = 109 Score = 81.6 bits (200), Expect = 6e-14 Identities = 43/68 (63%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Frame = +3 Query: 39 GPANPAQINFTQEPLDFRRECLSHPLSLLMSAFALLIPPASFSTHLNRITERSSTASP-E 215 GPA+PA+IN QEPL FRR+C SH SLLMSAF+L IPPA + HL+R TERS+T S Sbjct: 1 GPAHPARINLAQEPLGFRRKCFSHFFSLLMSAFSLPIPPAVLTDHLHRRTERSATTSSYS 60 Query: 216 GDTRSFGV 239 G T S GV Sbjct: 61 GRTNSHGV 68 >ref|YP_005415583.1| hypothetical protein RSPPHO_03274, partial [Rhodospirillum photometricum DSM 122] gi|378401497|emb|CCG06613.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 150 Score = 75.5 bits (184), Expect(2) = 6e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +1 Query: 76 NPWTFGESVFHTHYRYSCQHSHF*YLQQASQLTLTGLQNAPLPHH 210 NPW FG SV HT +RYSCQHSHF YLQQ+S+ T TG++NAPLP H Sbjct: 85 NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLPLH 129 Score = 23.1 bits (48), Expect(2) = 6e-13 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 219 DTRSFGVWFEPRYIF 263 + SFG EPRYIF Sbjct: 133 EIHSFGARLEPRYIF 147 >emb|CCG06598.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 150 Score = 75.5 bits (184), Expect(2) = 6e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +1 Query: 76 NPWTFGESVFHTHYRYSCQHSHF*YLQQASQLTLTGLQNAPLPHH 210 NPW FG SV HT +RYSCQHSHF YLQQ+S+ T TG++NAPLP H Sbjct: 85 NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLPLH 129 Score = 23.1 bits (48), Expect(2) = 6e-13 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 219 DTRSFGVWFEPRYIF 263 + SFG EPRYIF Sbjct: 133 EIHSFGARLEPRYIF 147 >ref|YP_005415588.1| hypothetical protein RSPPHO_03279 [Rhodospirillum photometricum DSM 122] gi|378401502|emb|CCG06618.1| unnamed protein product [Rhodospirillum photometricum DSM 122] Length = 104 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +1 Query: 76 NPWTFGESVFHTHYRYSCQHSHF*YLQQASQLTLTGLQNAPLPHH 210 NPW FG SV HT +RYSCQHSHF YLQQ+S+ T TG++NAPLP H Sbjct: 50 NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLPLH 94