BLASTX nr result
ID: Cephaelis21_contig00031681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031681 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis] 65 6e-09 gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp... 60 2e-07 tpg|DAA46175.1| TPA: putative cytochrome P450 superfamily protei... 60 2e-07 ref|XP_003574294.1| PREDICTED: carotene epsilon-monooxygenase, c... 60 2e-07 ref|XP_002467549.1| hypothetical protein SORBIDRAFT_01g030050 [S... 60 2e-07 >gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis] Length = 208 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 404 KAPSSLRKAQEEIDRVLQG*ALTYEDVKNLKFLMRCINE 288 K PSSL+KAQEE+DRVLQG TYED+KNLKFL RCINE Sbjct: 22 KDPSSLKKAQEEVDRVLQGRPPTYEDIKNLKFLTRCINE 60 >gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp. mays] gi|399151315|gb|AFP28223.1| carotene epsilon-ring hydroxylase [synthetic construct] Length = 556 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 404 KAPSSLRKAQEEIDRVLQG*ALTYEDVKNLKFLMRCINELM 282 K P++LR+AQ+E+DRVLQG YEDVK LK+LMRCINE M Sbjct: 368 KDPTALRRAQDEVDRVLQGRLPKYEDVKELKYLMRCINESM 408 >tpg|DAA46175.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 420 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 404 KAPSSLRKAQEEIDRVLQG*ALTYEDVKNLKFLMRCINELM 282 K P++LR+AQ+E+DRVLQG YEDVK LK+LMRCINE M Sbjct: 368 KDPTALRRAQDEVDRVLQGRLPKYEDVKELKYLMRCINESM 408 >ref|XP_003574294.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like [Brachypodium distachyon] Length = 550 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 404 KAPSSLRKAQEEIDRVLQG*ALTYEDVKNLKFLMRCINELM 282 K P++LR+AQ+E+DRVLQG YEDVK LK+LMRCINE M Sbjct: 362 KDPAALRRAQDEVDRVLQGRLPRYEDVKELKYLMRCINESM 402 >ref|XP_002467549.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor] gi|241921403|gb|EER94547.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor] Length = 538 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 404 KAPSSLRKAQEEIDRVLQG*ALTYEDVKNLKFLMRCINELM 282 K P++LR+AQ+E+DRVLQG YEDVK LK+LMRCINE M Sbjct: 367 KDPTALRRAQDEVDRVLQGRLPKYEDVKELKYLMRCINESM 407