BLASTX nr result
ID: Cephaelis21_contig00031525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031525 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG86625.1| type 2 proly 4-hydroxylase [Nicotiana tabacum] 77 1e-12 ref|XP_002877111.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 72 6e-11 gb|AAL57673.1| AT3g28480/MFJ20_16 [Arabidopsis thaliana] gi|2479... 69 3e-10 dbj|BAB02864.1| prolyl 4-hydroxylase alpha subunit-like protein ... 69 3e-10 ref|NP_001189994.1| prolyl 4-hydroxylase [Arabidopsis thaliana] ... 69 3e-10 >dbj|BAG86625.1| type 2 proly 4-hydroxylase [Nicotiana tabacum] Length = 318 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = -1 Query: 142 KGSVLRMKT---ASSATIDPSRVTQISWRPRAFIYRGFLTSEECDHFITL 2 K SVL++ T +SS TIDP+RVTQISWRPRAF+YR FLT EECDHFITL Sbjct: 40 KSSVLKLLTDRSSSSPTIDPTRVTQISWRPRAFVYRNFLTDEECDHFITL 89 >ref|XP_002877111.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297322949|gb|EFH53370.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 316 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -1 Query: 139 GSVLRMKT-ASSATIDPSRVTQISWRPRAFIYRGFLTSEECDHFITL 2 GSV++MKT ASS DP+RVTQ+SW PRAF+Y+GFL+ EECDHFI L Sbjct: 37 GSVIKMKTSASSFGFDPTRVTQLSWTPRAFLYKGFLSDEECDHFIKL 83 >gb|AAL57673.1| AT3g28480/MFJ20_16 [Arabidopsis thaliana] gi|24796986|gb|AAN64505.1| At3g28480/MFJ20_16 [Arabidopsis thaliana] Length = 316 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 139 GSVLRMKT-ASSATIDPSRVTQISWRPRAFIYRGFLTSEECDHFITL 2 GSV++MKT ASS DP+RVTQ+SW PR F+Y GFL+ EECDHFI L Sbjct: 37 GSVIKMKTSASSFGFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKL 83 >dbj|BAB02864.1| prolyl 4-hydroxylase alpha subunit-like protein [Arabidopsis thaliana] Length = 332 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 139 GSVLRMKT-ASSATIDPSRVTQISWRPRAFIYRGFLTSEECDHFITL 2 GSV++MKT ASS DP+RVTQ+SW PR F+Y GFL+ EECDHFI L Sbjct: 53 GSVIKMKTSASSFGFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKL 99 >ref|NP_001189994.1| prolyl 4-hydroxylase [Arabidopsis thaliana] gi|332643930|gb|AEE77451.1| prolyl 4-hydroxylase [Arabidopsis thaliana] Length = 324 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 139 GSVLRMKT-ASSATIDPSRVTQISWRPRAFIYRGFLTSEECDHFITL 2 GSV++MKT ASS DP+RVTQ+SW PR F+Y GFL+ EECDHFI L Sbjct: 37 GSVIKMKTSASSFGFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKL 83