BLASTX nr result
ID: Cephaelis21_contig00031320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031320 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|2235... 62 4e-08 ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002301577.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] g... 62 5e-08 ref|XP_004165963.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-rela... 62 6e-08 >ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|223536127|gb|EEF37782.1| auxilin, putative [Ricinus communis] Length = 983 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RIAETLDMEIKRWAAGKEGNLRALLSTLQYV 93 RIAETLD+EIKRWAAGKEGNLRALLSTLQYV Sbjct: 883 RIAETLDVEIKRWAAGKEGNLRALLSTLQYV 913 >ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|222861997|gb|EEE99539.1| predicted protein [Populus trichocarpa] Length = 941 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RIAETLDMEIKRWAAGKEGNLRALLSTLQYV 93 RIAETLD+EIKRWAAGKEGNLRALLSTLQYV Sbjct: 841 RIAETLDVEIKRWAAGKEGNLRALLSTLQYV 871 >ref|XP_002301577.1| predicted protein [Populus trichocarpa] gi|222843303|gb|EEE80850.1| predicted protein [Populus trichocarpa] Length = 155 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RIAETLDMEIKRWAAGKEGNLRALLSTLQYV 93 RIAETLD+EIKRWAAGKEGNLRALLSTLQYV Sbjct: 55 RIAETLDVEIKRWAAGKEGNLRALLSTLQYV 85 >ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] gi|355524340|gb|AET04794.1| Auxilin-like protein [Medicago truncatula] Length = 949 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 RIAETLDMEIKRWAAGKEGNLRALLSTLQYVC 96 R+ ETLD EIKRW+AGKEGNLRALLSTLQYVC Sbjct: 917 RLGETLDFEIKRWSAGKEGNLRALLSTLQYVC 948 >ref|XP_004165963.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 1-like [Cucumis sativus] Length = 974 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 RIAETLDMEIKRWAAGKEGNLRALLSTLQYV 93 RIAETLD EIKRWAAGKEGNLRALLSTLQYV Sbjct: 874 RIAETLDAEIKRWAAGKEGNLRALLSTLQYV 904