BLASTX nr result
ID: Cephaelis21_contig00031318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031318 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67718.1| hypothetical protein VITISV_002357 [Vitis vinifera] 62 6e-13 >emb|CAN67718.1| hypothetical protein VITISV_002357 [Vitis vinifera] Length = 449 Score = 61.6 bits (148), Expect(2) = 6e-13 Identities = 35/64 (54%), Positives = 44/64 (68%) Frame = +1 Query: 256 HQPTLFGHPHSQNLDVFPQSLANPSGSNTQYAHDVLWSRGLRSDPSNYANFGNITALSSS 435 H PTLF P S +D F QS ANP+ +N+ D +WSRGLRS+P N +FGN+T LSSS Sbjct: 54 HPPTLFD-PRSNYVDAFSQSSANPN-ANSLLNLDTVWSRGLRSEP-NCTDFGNLTGLSSS 110 Query: 436 AASS 447 + SS Sbjct: 111 STSS 114 Score = 37.0 bits (84), Expect(2) = 6e-13 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +2 Query: 71 DDEYDSRCESISSFLMNSSAHFGSISEPP 157 D+EY+SR ESI +FL N S HFGS+S P Sbjct: 16 DEEYESRPESIPAFL-NPSGHFGSVSSNP 43