BLASTX nr result
ID: Cephaelis21_contig00031312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031312 (834 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 87 5e-15 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 84 4e-14 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 79 2e-12 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 72 1e-10 gb|AFK45340.1| unknown [Medicago truncatula] 71 3e-10 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Frame = -3 Query: 559 CKMNHCRRRRLLPSIQLAWLVVVMACIFIVGSHGARN-AHVFKLNPRTQNPGHFFNFLPK 383 C RRRR L + L W+++++ F HG+R A+VF + P+ Q+ GHF NFLP+ Sbjct: 5 CGSGRRRRRRSLVFL-LFWILLLLFISFFGYCHGSRTTANVFDVKPKNQHRGHFLNFLPR 63 Query: 382 RFPIPASGPSRKHNEIGLQDWRLP 311 FPIP SGPSR+HN+IGLQ WR P Sbjct: 64 HFPIPTSGPSRRHNDIGLQSWRSP 87 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/78 (51%), Positives = 49/78 (62%) Frame = -3 Query: 544 CRRRRLLPSIQLAWLVVVMACIFIVGSHGARNAHVFKLNPRTQNPGHFFNFLPKRFPIPA 365 CRR P L L + F+ SHG+R+ +VF P+TQ GHF NFLP+ PIP Sbjct: 5 CRR----PLTLLLCLFFLFFIFFVGYSHGSRSTNVFNFKPKTQYKGHFLNFLPRHLPIPT 60 Query: 364 SGPSRKHNEIGLQDWRLP 311 SGPSR+HN IGLQ+WR P Sbjct: 61 SGPSRRHNGIGLQNWRSP 78 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/79 (50%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = -3 Query: 544 CRRRRLLPSIQLAWLVVVMACIFIVGS-HGARNAHVFKLNPRTQNPGHFFNFLPKRFPIP 368 CRR L I WL++++ FI+G HG+R + FK+ P++++ GHFF FLPKR IP Sbjct: 4 CRRPLQLLVI---WLLLIL---FILGQCHGSRTTNDFKVKPKSEHQGHFFGFLPKRMHIP 57 Query: 367 ASGPSRKHNEIGLQDWRLP 311 S PSRKHN+IGL+ WR P Sbjct: 58 YSTPSRKHNDIGLRSWRSP 76 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/66 (53%), Positives = 46/66 (69%), Gaps = 2/66 (3%) Frame = -3 Query: 502 LVVVMACIFIVGSH--GARNAHVFKLNPRTQNPGHFFNFLPKRFPIPASGPSRKHNEIGL 329 L+++ CIF H G+R +VFK+ P+ ++ GHFF FLP+R PIP S PSRKHN+IGL Sbjct: 14 LLLLFLCIF---GHCDGSRATNVFKVKPKYEHKGHFFGFLPRRIPIPYSSPSRKHNDIGL 70 Query: 328 QDWRLP 311 Q R P Sbjct: 71 QSLRSP 76 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = -3 Query: 502 LVVVMACIFIVGSH--GARNAHVFKLNPRTQNPGHFFNFLPKRFPIPASGPSRKHNEIGL 329 L+++ CIF H G+R +VFK+ P+ ++ GHFF FLP R PIP S PSRKHN+IGL Sbjct: 14 LLLLFLCIF---GHCDGSRATNVFKVKPKYEHKGHFFGFLPGRIPIPYSSPSRKHNDIGL 70 Query: 328 QDWRLP 311 Q R P Sbjct: 71 QSLRSP 76