BLASTX nr result
ID: Cephaelis21_contig00031310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031310 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus c... 60 2e-07 >ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374082010|gb|AEY81202.1| orf57 (mitochondrion) [Daucus carota subsp. sativus] Length = 122 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 2/89 (2%) Frame = +3 Query: 36 MINILSWNIRDIGNSASLRRLKKICQTKKFSVVTVLEPFLSTDKIADVASALGFQNYFSN 215 MIN L WNIR IGN S RR+ K+ + S++ +LEP +KI + ++ + F +N Sbjct: 1 MINNLLWNIRGIGNIKSRRRVGKLVKMYNISLIAILEPLHHANKIQEFSNRIRFNFSLAN 60 Query: 216 NIS--KIWIFWNQNILLNLVTHSDQLVHV 296 + KIW+ WN + + LV +Q + V Sbjct: 61 QEADDKIWLCWNHEVHVVLVDAFEQCITV 89