BLASTX nr result
ID: Cephaelis21_contig00031305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031305 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23079.3| unnamed protein product [Vitis vinifera] 64 1e-08 >emb|CBI23079.3| unnamed protein product [Vitis vinifera] Length = 86 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -1 Query: 205 KFLRG*GD-KFYFEYIIALELLGAYEQWSLWSTAHCKDCSLGLL 77 K LRG + KFYF++IIA+E LGAYEQWSLWSTAH +DCSL L Sbjct: 41 KILRGDEESKFYFKFIIAVEHLGAYEQWSLWSTAHLEDCSLAKL 84