BLASTX nr result
ID: Cephaelis21_contig00031200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031200 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago ... 57 2e-06 dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula] 57 2e-06 ref|XP_002269594.2| PREDICTED: secologanin synthase-like [Vitis ... 56 4e-06 ref|XP_003521637.1| PREDICTED: LOW QUALITY PROTEIN: secologanin ... 55 5e-06 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila] 55 5e-06 >gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] Length = 518 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -3 Query: 348 LVLRRFSWTLSPSYKHAPKTLFTIKPQYGAHIIMQKI 238 ++L+RFS+ LSPSY HAP T+ T++PQYGAHII+ K+ Sbjct: 480 MILQRFSFELSPSYAHAPATVITLQPQYGAHIILHKL 516 >dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula] Length = 518 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -3 Query: 348 LVLRRFSWTLSPSYKHAPKTLFTIKPQYGAHIIMQKI 238 ++L+RFS+ LSPSY HAP T+ T++PQYGAHII+ K+ Sbjct: 480 MILQRFSFELSPSYAHAPATVITLQPQYGAHIILHKL 516 >ref|XP_002269594.2| PREDICTED: secologanin synthase-like [Vitis vinifera] Length = 564 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = -3 Query: 348 LVLRRFSWTLSPSYKHAPKTLFTIKPQYGAHIIMQKI 238 ++L+RFS++LSPSY HAP +L T+KPQYGAH+I++ + Sbjct: 482 MILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILRSL 518 >ref|XP_003521637.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Glycine max] Length = 510 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/36 (58%), Positives = 32/36 (88%) Frame = -3 Query: 345 VLRRFSWTLSPSYKHAPKTLFTIKPQYGAHIIMQKI 238 +L+ FS+ LSP+Y HAP T+FT++PQYGAH+I++K+ Sbjct: 473 ILQHFSFELSPAYAHAPVTVFTLQPQYGAHVILRKV 508 >dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila] Length = 512 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 348 LVLRRFSWTLSPSYKHAPKTLFTIKPQYGAHIIMQKI 238 L+L RFS LSPSY HAP T+FTI PQ+GAH+I+ K+ Sbjct: 476 LILHRFSLELSPSYVHAPYTVFTIHPQFGAHLILHKL 512