BLASTX nr result
ID: Cephaelis21_contig00031152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031152 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534699.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002534699.1| conserved hypothetical protein [Ricinus communis] gi|223524744|gb|EEF27685.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/68 (39%), Positives = 42/68 (61%) Frame = -2 Query: 215 PMLFIIMAEALTRGLKLQMENNIILPYSLPRKAPLISHLSFADDIIIFTRGSKNSLQ*LI 36 P L I+ E L+RGL+ + +I PY R P +SHL FA+D+++ G K +L+ L Sbjct: 38 PSLLILAEEVLSRGLQELVSLKMITPYHALRSCPTLSHLLFANDVLVLYNGHKRNLKKLK 97 Query: 35 LFLEASRR 12 +FLE S++ Sbjct: 98 IFLETSKK 105