BLASTX nr result
ID: Cephaelis21_contig00031133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031133 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q6DW74.1|DGDG1_LOTJA RecName: Full=Digalactosyldiacylglycerol... 55 8e-06 >sp|Q6DW74.1|DGDG1_LOTJA RecName: Full=Digalactosyldiacylglycerol synthase 1, chloroplastic; Flags: Precursor gi|49617333|gb|AAT67422.1| digalactosyldiacylglycerol synthase 1 [Lotus japonicus] Length = 786 Score = 54.7 bits (130), Expect = 8e-06 Identities = 47/111 (42%), Positives = 59/111 (53%), Gaps = 8/111 (7%) Frame = -1 Query: 450 SFVDKSPKDGKRSADADL*LSKNWANFFKNITERA*EFPR-LCFKIDLVVPTISA----S 286 SF+ K ++ + SADADL L K+ AN FKN+ A F R L + P S S Sbjct: 15 SFLSKGWREVRDSADADLQLMKDRANSFKNL---ATSFDRELENFFNSAAPAFSVPAMRS 71 Query: 285 VTVTPMEIDFVKKLGPKLNEF*RAYLSVEL---YVETAEP*A*NAIDFSTI 142 + P EI+FVKKL PKL+EF RAY S + +E P A ID S I Sbjct: 72 ASPPPAEIEFVKKLQPKLSEFRRAYSSPDFSKKVLEKWRPRARIRIDLSAI 122