BLASTX nr result
ID: Cephaelis21_contig00031076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031076 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565475.1| fasciclin-like arabinogalactan protein 6 [Arabi... 60 1e-07 ref|XP_002884207.1| hypothetical protein ARALYDRAFT_480881 [Arab... 60 1e-07 ref|XP_002517840.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002325592.1| fasciclin-like arabinogalactan protein 9.2 [... 56 3e-06 ref|NP_001238356.1| uncharacterized protein LOC100527846 precurs... 55 8e-06 >ref|NP_565475.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana] gi|75206133|sp|Q9SIL7.2|FLA6_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 6; Flags: Precursor gi|13377780|gb|AAK20859.1|AF333972_1 fasciclin-like arabinogalactan-protein 6 [Arabidopsis thaliana] gi|20198085|gb|AAD25652.2| putative surface protein [Arabidopsis thaliana] gi|330251928|gb|AEC07022.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana] Length = 247 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 322 FGLYFSGEANQNQVNVSTRLVQTTIYNTVRKDFPLAVFEVDKVLWPSE 179 FGL F+G+A NQVNVST +V+T I N +R+ FPLAV+ VD VL P E Sbjct: 139 FGLNFTGQAQSNQVNVSTGVVETRINNALRQQFPLAVYVVDSVLLPEE 186 >ref|XP_002884207.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. lyrata] gi|297330047|gb|EFH60466.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 322 FGLYFSGEANQNQVNVSTRLVQTTIYNTVRKDFPLAVFEVDKVLWPSE 179 FGL F+G+A NQVNVST +V+T I N +R+ FPLAV+ VD VL P E Sbjct: 139 FGLNFTGQAQSNQVNVSTGVVETRINNALRQQFPLAVYVVDSVLLPEE 186 >ref|XP_002517840.1| conserved hypothetical protein [Ricinus communis] gi|223542822|gb|EEF44358.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 322 FGLYFSGEANQNQVNVSTRLVQTTIYNTVRKDFPLAVFEVDKVLWPSE 179 FGL F+G+ANQ VNVST +V+T I N +R+ FPLA+++VDKVL P E Sbjct: 138 FGLNFTGQANQ--VNVSTGIVETQINNAIRQQFPLALYQVDKVLLPEE 183 >ref|XP_002325592.1| fasciclin-like arabinogalactan protein 9.2 [Populus trichocarpa] gi|222862467|gb|EEE99973.1| fasciclin-like arabinogalactan protein 9.2 [Populus trichocarpa] Length = 245 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -3 Query: 322 FGLYFSGEANQNQVNVSTRLVQTTIYNTVRKDFPLAVFEVDKVLWPSE 179 +GL F+G++NQ VNVST LV+ + N +R+DFPLAV+ VDKVL P E Sbjct: 138 WGLNFTGQSNQ--VNVSTGLVEVQVNNALRQDFPLAVYPVDKVLLPDE 183 >ref|NP_001238356.1| uncharacterized protein LOC100527846 precursor [Glycine max] gi|255633364|gb|ACU17039.1| unknown [Glycine max] Length = 250 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -3 Query: 322 FGLYFSGEANQNQVNVSTRLVQTTIYNTVRKDFPLAVFEVDKVLWPSE 179 +GL F+G+ NQVN+ST +VQT + N +R+ FPLAV++VDKVL P E Sbjct: 135 WGLNFTGQGG-NQVNISTGVVQTQLNNALREKFPLAVYQVDKVLLPLE 181