BLASTX nr result
ID: Cephaelis21_contig00031044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00031044 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38686.3| unnamed protein product [Vitis vinifera] 62 6e-08 >emb|CBI38686.3| unnamed protein product [Vitis vinifera] Length = 277 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 233 ATFLLWNSLNYTRCGALFFYLHSSPDSDLSLAAHGQLVKVTG 358 A FL+WN++N+ R ALF YL S PDSDL LA HGQLVK+TG Sbjct: 42 AAFLIWNTVNWRRSRALFCYLRSFPDSDLRLARHGQLVKITG 83