BLASTX nr result
ID: Cephaelis21_contig00030519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030519 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri] 71 8e-11 gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri] 71 8e-11 gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus] 70 2e-10 gb|AEX99665.1| amyrin synthase [Catharanthus roseus] 70 2e-10 dbj|BAF63702.1| mixed amyrin synthase [Olea europaea] 69 3e-10 >gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri] Length = 643 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 201 MKNCMLHYAEYRNIFPLWALSEYRKRVWPSQNL 103 MKNCMLHYA+YRNIFPLWALSEYR+RVWPSQ L Sbjct: 605 MKNCMLHYAQYRNIFPLWALSEYRRRVWPSQIL 637 >gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri] Length = 764 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 201 MKNCMLHYAEYRNIFPLWALSEYRKRVWPSQNL 103 MKNCMLHYA+YRNIFPLWALSEYR+RVWPSQ L Sbjct: 726 MKNCMLHYAQYRNIFPLWALSEYRRRVWPSQIL 758 >gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus] Length = 762 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 201 MKNCMLHYAEYRNIFPLWALSEYRKRVWPSQNL 103 MKNCMLHYAEYRNIFPLWAL+EYRKRVWP++ L Sbjct: 730 MKNCMLHYAEYRNIFPLWALAEYRKRVWPTKAL 762 >gb|AEX99665.1| amyrin synthase [Catharanthus roseus] Length = 762 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 201 MKNCMLHYAEYRNIFPLWALSEYRKRVWPSQNL 103 MKNCMLHYAEYRNIFPLWAL+EYRKRVWP++ L Sbjct: 730 MKNCMLHYAEYRNIFPLWALAEYRKRVWPTKAL 762 >dbj|BAF63702.1| mixed amyrin synthase [Olea europaea] Length = 762 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 201 MKNCMLHYAEYRNIFPLWALSEYRKRVWPSQNL 103 MKNCMLHYA+YRNIFPLWAL EYRKRVW SQ+L Sbjct: 730 MKNCMLHYAQYRNIFPLWALGEYRKRVWSSQSL 762