BLASTX nr result
ID: Cephaelis21_contig00029861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029861 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO42182.1| putative cell division-related protein [Arabidops... 84 3e-24 ref|NP_175713.1| protein kinase-like protein [Arabidopsis thalia... 84 3e-24 ref|XP_003596750.1| Serine/threonine protein kinase cdk9 [Medica... 80 1e-23 ref|XP_002511120.1| DNA binding protein, putative [Ricinus commu... 78 2e-23 ref|XP_002328793.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-23 >gb|AAO42182.1| putative cell division-related protein [Arabidopsis thaliana] Length = 694 Score = 84.0 bits (206), Expect(2) = 3e-24 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -2 Query: 291 PVNKTLIMKVRYYIQQLLHILDHCHIRGVLHRDIKGSNLLLDNKSTLKTADFGLATFF 118 P K +V+ Y+QQLLH LDHCH RGVLHRDIKGSNLL+DN LK ADFGLA+FF Sbjct: 226 PAIKFSESQVKCYLQQLLHGLDHCHSRGVLHRDIKGSNLLIDNSGVLKIADFGLASFF 283 Score = 52.8 bits (125), Expect(2) = 3e-24 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -1 Query: 100 PLISYDVTLWYRPLELLLGACYYRAAVDLWSAG 2 PL S VTLWYRP ELLLGA Y AAVDLWSAG Sbjct: 290 PLTSRVVTLWYRPPELLLGATRYGAAVDLWSAG 322 >ref|NP_175713.1| protein kinase-like protein [Arabidopsis thaliana] gi|9454540|gb|AAF87863.1|AC022520_7 similar to cdc2 protein kinase [Arabidopsis thaliana] gi|332194763|gb|AEE32884.1| protein kinase-like protein [Arabidopsis thaliana] Length = 694 Score = 84.0 bits (206), Expect(2) = 3e-24 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -2 Query: 291 PVNKTLIMKVRYYIQQLLHILDHCHIRGVLHRDIKGSNLLLDNKSTLKTADFGLATFF 118 P K +V+ Y+QQLLH LDHCH RGVLHRDIKGSNLL+DN LK ADFGLA+FF Sbjct: 226 PAIKFSESQVKCYLQQLLHGLDHCHSRGVLHRDIKGSNLLIDNSGVLKIADFGLASFF 283 Score = 52.8 bits (125), Expect(2) = 3e-24 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -1 Query: 100 PLISYDVTLWYRPLELLLGACYYRAAVDLWSAG 2 PL S VTLWYRP ELLLGA Y AAVDLWSAG Sbjct: 290 PLTSRVVTLWYRPPELLLGATRYGAAVDLWSAG 322 >ref|XP_003596750.1| Serine/threonine protein kinase cdk9 [Medicago truncatula] gi|355485798|gb|AES67001.1| Serine/threonine protein kinase cdk9 [Medicago truncatula] Length = 712 Score = 80.1 bits (196), Expect(2) = 1e-23 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -2 Query: 267 KVRYYIQQLLHILDHCHIRGVLHRDIKGSNLLLDNKSTLKTADFGLATFF 118 +V+ Y+QQLL LDHCH RGVLHRDIKGSNLL+DN LK ADFGLA+FF Sbjct: 234 QVKCYMQQLLRGLDHCHSRGVLHRDIKGSNLLIDNNGVLKIADFGLASFF 283 Score = 54.3 bits (129), Expect(2) = 1e-23 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -1 Query: 106 NIPLISYDVTLWYRPLELLLGACYYRAAVDLWSAG 2 N PL S VTLWYRP ELLLGA YY AVDLWS G Sbjct: 288 NQPLTSRVVTLWYRPPELLLGATYYGTAVDLWSTG 322 >ref|XP_002511120.1| DNA binding protein, putative [Ricinus communis] gi|223550235|gb|EEF51722.1| DNA binding protein, putative [Ricinus communis] Length = 2299 Score = 78.2 bits (191), Expect(2) = 2e-23 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -2 Query: 267 KVRYYIQQLLHILDHCHIRGVLHRDIKGSNLLLDNKSTLKTADFGLATFF 118 +++ Y++QLL L+HCH RGVLHRDIKGSNLL+DN+ LK ADFGLATFF Sbjct: 206 QIKCYVKQLLAGLEHCHKRGVLHRDIKGSNLLIDNEGVLKIADFGLATFF 255 Score = 55.5 bits (132), Expect(2) = 2e-23 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -1 Query: 112 DKNIPLISYDVTLWYRPLELLLGACYYRAAVDLWSAG 2 ++ +P+ S VTLWYRP ELLLGA YY VDLWSAG Sbjct: 258 ERKVPMTSRVVTLWYRPPELLLGATYYSVGVDLWSAG 294 >ref|XP_002328793.1| predicted protein [Populus trichocarpa] gi|222839091|gb|EEE77442.1| predicted protein [Populus trichocarpa] Length = 313 Score = 82.8 bits (203), Expect(2) = 2e-23 Identities = 40/64 (62%), Positives = 46/64 (71%) Frame = -2 Query: 309 ASALVQPVNKTLIMKVRYYIQQLLHILDHCHIRGVLHRDIKGSNLLLDNKSTLKTADFGL 130 A L P K +++ Y+QQLLH L+HCH RGVLHRDIKGSNLL+D LK ADFGL Sbjct: 83 AGLLASPGIKFTEAQIKCYMQQLLHGLEHCHSRGVLHRDIKGSNLLIDTNGNLKIADFGL 142 Query: 129 ATFF 118 ATFF Sbjct: 143 ATFF 146 Score = 50.8 bits (120), Expect(2) = 2e-23 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 100 PLISYDVTLWYRPLELLLGACYYRAAVDLWSAG 2 PL S VTLWYRP ELLLGA Y AVDLWSAG Sbjct: 153 PLTSRVVTLWYRPPELLLGATDYGVAVDLWSAG 185