BLASTX nr result
ID: Cephaelis21_contig00029500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029500 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002493342.1| hypothetical protein A2cp1_2939 [Anaeromyxob... 55 5e-06 >ref|YP_002493342.1| hypothetical protein A2cp1_2939 [Anaeromyxobacter dehalogenans 2CP-1] gi|219955892|gb|ACL66276.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans 2CP-1] Length = 705 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/79 (36%), Positives = 32/79 (40%), Gaps = 4/79 (5%) Frame = -1 Query: 309 DKGTCATDSDCCSG----GTCNGFQFCCASTGQACSDYVECCDVQITLPGAGGGSGKDCI 142 D G C CC+G GTC C + G AC ECC P AGGG C Sbjct: 78 DGGACGAGKPCCTGFCEGGTCTQGSTTCKADGSACGSAAECCS-PTCAPPAGGGQAV-CG 135 Query: 141 AGKCCADFGADCQTNTDCC 85 + CA G C DCC Sbjct: 136 TSEFCAPAGEACSAAADCC 154