BLASTX nr result
ID: Cephaelis21_contig00029290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029290 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 50 2e-07 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 50 2e-07 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 58 7e-07 ref|XP_004154607.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 ref|XP_004140023.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 253 NLDQAINVFLYTVEKGFRLMPRICNNLLMCLL 158 NL+ A+++FLYT+EKGF LMPRICN LL L+ Sbjct: 718 NLEMAVDIFLYTLEKGFMLMPRICNQLLRSLI 749 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 125 LLKEMKFMGYNLDAYLYGSTKSLLSHCSKRMQVEYVLHG 9 LL M GY+LD YL+ KS L K ++E V G Sbjct: 760 LLNRMNSAGYDLDEYLHHRIKSYLLSVWKAQEMENVAPG 798 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 253 NLDQAINVFLYTVEKGFRLMPRICNNLLMCLL 158 NL+ A+++FLYT+EKGF LMPRICN LL L+ Sbjct: 642 NLEMAVDIFLYTLEKGFMLMPRICNQLLRSLI 673 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 125 LLKEMKFMGYNLDAYLYGSTKSLLSHCSKRMQVEYVLHG 9 LL M GY+LD YL+ KS L K ++E V G Sbjct: 684 LLNRMNSAGYDLDEYLHHRIKSYLLSVWKAQEMENVAPG 722 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -3 Query: 253 NLDQAINVFLYTVEKGFRLMPRICNNLLMCLLHSEEKAQNAF 128 NLD A +FLYT++KG+ LMPRICN LL LL SE+K AF Sbjct: 713 NLDLAAEIFLYTIDKGYMLMPRICNRLLKSLLRSEDKRNRAF 754 >ref|XP_004154607.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Cucumis sativus] Length = 950 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 253 NLDQAINVFLYTVEKGFRLMPRICNNLLMCLLHSEEKAQNAFIFSK 116 NLD A++VFL+T+E+GFRLMP ICN LL LLH + K F+ ++ Sbjct: 715 NLDMAMDVFLFTLERGFRLMPPICNQLLCNLLHLDRKDDALFLANR 760 >ref|XP_004140023.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Cucumis sativus] Length = 783 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 253 NLDQAINVFLYTVEKGFRLMPRICNNLLMCLLHSEEKAQNAFIFSK 116 NLD A++VFL+T+E+GFRLMP ICN LL LLH + K F+ ++ Sbjct: 715 NLDMAMDVFLFTLERGFRLMPPICNQLLCNLLHLDRKDDALFLANR 760