BLASTX nr result
ID: Cephaelis21_contig00029275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029275 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510562.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002510562.1| conserved hypothetical protein [Ricinus communis] gi|223551263|gb|EEF52749.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +3 Query: 348 MVLECFQWIVHLLNESVGLFSFSTEGGVVRQLPDDVVVDILSRLPAERVVEC 503 M ECF WIVH+ E + +F +GG VR LP+D++ +ILSRLPA+ V++C Sbjct: 1 MEFECFIWIVHIWKELLSIFP-PLKGGDVRPLPNDIIFEILSRLPADEVLKC 51