BLASTX nr result
ID: Cephaelis21_contig00029122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029122 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632373.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosi... 55 6e-06 emb|CBI36852.3| unnamed protein product [Vitis vinifera] 55 6e-06 >ref|XP_003632373.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 11-like [Vitis vinifera] Length = 512 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 210 GIQPHVTLFHDDLPQALEDKYGGFLSRRFV 299 GIQPHVTLFH DLPQALED+Y G++SRR V Sbjct: 141 GIQPHVTLFHSDLPQALEDEYEGWISRRIV 170 >emb|CBI36852.3| unnamed protein product [Vitis vinifera] Length = 196 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 210 GIQPHVTLFHDDLPQALEDKYGGFLSRRFV 299 GIQPHVTLFH DLPQALED+Y G++SRR V Sbjct: 156 GIQPHVTLFHSDLPQALEDEYEGWISRRIV 185