BLASTX nr result
ID: Cephaelis21_contig00029109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029109 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234182.1| exportin 1 [Solanum lycopersicum] gi|2680535... 63 2e-08 ref|NP_197204.1| exportin 1A [Arabidopsis thaliana] gi|5931694|e... 62 6e-08 ref|XP_003633992.1| PREDICTED: exportin-1 isoform 3 [Vitis vinif... 62 6e-08 ref|XP_003633991.1| PREDICTED: exportin-1 isoform 2 [Vitis vinif... 62 6e-08 ref|NP_001190324.1| exportin 1A [Arabidopsis thaliana] gi|332004... 62 6e-08 >ref|NP_001234182.1| exportin 1 [Solanum lycopersicum] gi|268053527|gb|ACY92425.1| exportin-1 [Solanum lycopersicum] Length = 1075 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 25 LQVLEGVIKYRWNALPVE*HNGMKNYISEVIIKVAA 132 LQVLEGVIKYRWNALPVE +GMKNYISEVI+K+++ Sbjct: 71 LQVLEGVIKYRWNALPVEQRDGMKNYISEVIVKLSS 106 >ref|NP_197204.1| exportin 1A [Arabidopsis thaliana] gi|5931694|emb|CAB56597.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|7671510|emb|CAB89280.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|9755703|emb|CAC01715.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|15810123|gb|AAL07205.1| putative exportin1 protein XPO1 [Arabidopsis thaliana] gi|20465601|gb|AAM20283.1| putative Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|332004990|gb|AED92373.1| exportin 1A [Arabidopsis thaliana] Length = 1075 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 25 LQVLEGVIKYRWNALPVE*HNGMKNYISEVIIKVAA 132 LQVLEGVIKYRWNALPVE +GMKNYISEVI+++++ Sbjct: 71 LQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSS 106 >ref|XP_003633992.1| PREDICTED: exportin-1 isoform 3 [Vitis vinifera] Length = 1069 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 25 LQVLEGVIKYRWNALPVE*HNGMKNYISEVIIKVAA 132 LQVLEGVIKYRWNALPVE +GMKNYISEVI+++++ Sbjct: 71 LQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSS 106 >ref|XP_003633991.1| PREDICTED: exportin-1 isoform 2 [Vitis vinifera] Length = 1061 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 25 LQVLEGVIKYRWNALPVE*HNGMKNYISEVIIKVAA 132 LQVLEGVIKYRWNALPVE +GMKNYISEVI+++++ Sbjct: 71 LQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSS 106 >ref|NP_001190324.1| exportin 1A [Arabidopsis thaliana] gi|332004991|gb|AED92374.1| exportin 1A [Arabidopsis thaliana] Length = 1060 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 25 LQVLEGVIKYRWNALPVE*HNGMKNYISEVIIKVAA 132 LQVLEGVIKYRWNALPVE +GMKNYISEVI+++++ Sbjct: 71 LQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSS 106