BLASTX nr result
ID: Cephaelis21_contig00029082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00029082 (612 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522091.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002522091.1| conserved hypothetical protein [Ricinus communis] gi|223538690|gb|EEF40291.1| conserved hypothetical protein [Ricinus communis] Length = 868 Score = 64.3 bits (155), Expect = 2e-08 Identities = 56/201 (27%), Positives = 88/201 (43%), Gaps = 3/201 (1%) Frame = -3 Query: 598 EQETEEKTIGELFSQEAQDMSKDVLYDTGK--PKPSILRILKSVSLLLILAAACVSFCVT 425 E+E EE+ EL E ++ + T K KP+ K +LL +LA AC+ V+ Sbjct: 326 EEEEEEEEEEELLVSEPNPINASEVAVTAKRVSKPNFFTRTKFTALLFVLAIACLWASVS 385 Query: 424 ICPSMDTSVLDTLKPPKLPDRSEIGLLTKANLNQLGARFKRLSYDSISHLSLLVNKLGRG 245 P MD SVL+ L L EI T+ NL L +F++ Y+ +S++ L+ G Sbjct: 386 NSPVMDPSVLNNLSFSNLYVPPEITEFTRDNLEGLAQKFRQWLYEYLSYIHSLIISFGEQ 445 Query: 244 DNFGHVLFINL-TFLEDEAVCNSFDDLQQSLAQIKDLXXXXXXXXXXXEAAFSDEPTYPK 68 + F NL T L+D+ V N+F S + + + ++ P Sbjct: 446 RRPAPLQFANLSTLLKDDLVDNNFILAGHSTFKYESNELGPIKEEEVDIKSLKEQKVQP- 504 Query: 67 MVSDDSSERELEDASELGAEE 5 + D + E+ DA L EE Sbjct: 505 -IDSDENIEEVADAKLLEKEE 524