BLASTX nr result
ID: Cephaelis21_contig00028948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028948 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001032152.1| zinc ion binding protein [Arabidopsis thalia... 61 8e-08 ref|XP_002866688.1| hypothetical protein ARALYDRAFT_496810 [Arab... 60 2e-07 >ref|NP_001032152.1| zinc ion binding protein [Arabidopsis thaliana] gi|222424329|dbj|BAH20121.1| AT5G65740 [Arabidopsis thaliana] gi|332010715|gb|AED98098.1| zinc ion binding protein [Arabidopsis thaliana] Length = 300 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +3 Query: 132 MDVNMERADDNACREFRKSSAFYRRIYSEVDEVGWEHLVKMGEDLTFLSFRI 287 M+V+ E C E KSS+FYR++YSE++E+GWE + ++G DLTF SF I Sbjct: 2 MNVSGECVGRERCEELAKSSSFYRKVYSEIEEIGWEPIRRLGGDLTFFSFHI 53 >ref|XP_002866688.1| hypothetical protein ARALYDRAFT_496810 [Arabidopsis lyrata subsp. lyrata] gi|297312523|gb|EFH42947.1| hypothetical protein ARALYDRAFT_496810 [Arabidopsis lyrata subsp. lyrata] Length = 308 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +3 Query: 168 CREFRKSSAFYRRIYSEVDEVGWEHLVKMGEDLTFLSFRI 287 C E KSS+FYR++YSE++E+GWE L ++G DLTF SF+I Sbjct: 14 CEELAKSSSFYRKVYSEIEEIGWEPLRRLGGDLTFFSFQI 53