BLASTX nr result
ID: Cephaelis21_contig00028706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028706 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACE60600.1| mannan synthase [Coffea canephora] 68 7e-10 gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum] 64 2e-08 emb|CBI32777.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vin... 63 3e-08 gb|ACE60601.1| mannan synthase [Coffea arabica] 63 3e-08 >gb|ACE60600.1| mannan synthase [Coffea canephora] Length = 530 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 32 QVYKLSIGAACGLSWPSNRLIVQVLDDSTNEVLR 133 +VYKLSIGAACGLSWPS+RLIVQVLDDSTNEVLR Sbjct: 107 EVYKLSIGAACGLSWPSDRLIVQVLDDSTNEVLR 140 >gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum] Length = 534 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 32 QVYKLSIGAACGLSWPSNRLIVQVLDDSTNEVLR 133 +VYKLSIGA CGLSWP +RLIVQVLDDSTN+VLR Sbjct: 105 EVYKLSIGAVCGLSWPRDRLIVQVLDDSTNQVLR 138 >emb|CBI32777.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 32 QVYKLSIGAACGLSWPSNRLIVQVLDDSTNEVLRV 136 +VYKLSIGAAC +SWPS+R I+QVLDDSTNE LRV Sbjct: 59 EVYKLSIGAACSVSWPSDRFIIQVLDDSTNEALRV 93 >ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vinifera] Length = 526 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 32 QVYKLSIGAACGLSWPSNRLIVQVLDDSTNEVLRV 136 +VYKLSIGAAC +SWPS+R I+QVLDDSTNE LRV Sbjct: 105 EVYKLSIGAACSVSWPSDRFIIQVLDDSTNEALRV 139 >gb|ACE60601.1| mannan synthase [Coffea arabica] Length = 530 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 32 QVYKLSIGAACGLSWPSNRLIVQVLDDSTNEVLR 133 +VYKLSIGAACGLS PS+RLIVQVLDDSTNEVLR Sbjct: 107 EVYKLSIGAACGLSRPSDRLIVQVLDDSTNEVLR 140