BLASTX nr result
ID: Cephaelis21_contig00028587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028587 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ55299.1| methyltransferase [Coffea arabica] 60 2e-07 gb|ADY38788.1| methyltransferase [Coffea arabica] 57 2e-06 gb|ABZ89181.1| hypothetical protein 46C02.7 [Coffea canephora] 57 2e-06 >gb|ADZ55299.1| methyltransferase [Coffea arabica] Length = 315 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 266 MSKEKTEATNYYSKDFEWEHLRHEIETDPTLLYHLLPF 379 MS+E A NYYSKDFEW HLR EIET+P+ LYHLLPF Sbjct: 1 MSQEA--AANYYSKDFEWNHLRLEIETNPSFLYHLLPF 36 >gb|ADY38788.1| methyltransferase [Coffea arabica] Length = 315 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 266 MSKEKTEATNYYSKDFEWEHLRHEIETDPTLLYHLLPF 379 MS+E A NYYSKDFEW LR EIET+P+ LYHLLPF Sbjct: 1 MSQEA--AANYYSKDFEWNQLRLEIETNPSFLYHLLPF 36 >gb|ABZ89181.1| hypothetical protein 46C02.7 [Coffea canephora] Length = 315 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 266 MSKEKTEATNYYSKDFEWEHLRHEIETDPTLLYHLLPF 379 MS+E A NYYSKDFEW LR EIET+P+ LYHLLPF Sbjct: 1 MSQEA--AANYYSKDFEWNQLRLEIETNPSFLYHLLPF 36