BLASTX nr result
ID: Cephaelis21_contig00028239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028239 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533380.1| conserved hypothetical protein [Ricinus comm... 48 3e-10 emb|CAN72301.1| hypothetical protein VITISV_024923 [Vitis vinifera] 45 5e-09 ref|XP_002272110.1| PREDICTED: uncharacterized protein LOC100260... 45 5e-09 emb|CBI25472.3| unnamed protein product [Vitis vinifera] 45 5e-09 ref|XP_002316210.1| predicted protein [Populus trichocarpa] gi|2... 44 1e-08 >ref|XP_002533380.1| conserved hypothetical protein [Ricinus communis] gi|223526773|gb|EEF28998.1| conserved hypothetical protein [Ricinus communis] Length = 1112 Score = 47.8 bits (112), Expect(2) = 3e-10 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -3 Query: 203 GEQSFWGVLSSSEIKIALLRPVHHQLLRYARYKGPPMFLCNLYGDSEPKLG 51 GE F SSEIK+A++RP+ L R++GPPMFLCNL S+P G Sbjct: 156 GESGF----RSSEIKLAIVRPLPQVLRLSQRFRGPPMFLCNLSDHSDPGPG 202 Score = 41.6 bits (96), Expect(2) = 3e-10 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 244 ELQTLILSILDDPMVSRVFGES 179 ELQ LILSILDDP+VSRVFGES Sbjct: 137 ELQNLILSILDDPVVSRVFGES 158 >emb|CAN72301.1| hypothetical protein VITISV_024923 [Vitis vinifera] Length = 1166 Score = 45.4 bits (106), Expect(2) = 5e-09 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -3 Query: 173 SSEIKIALLRPVHHQLLRYARYKGPPMFLCNLYGDSEP 60 S +IK+A++RP+ QLLRY+R +GPP+FLCN + DS+P Sbjct: 162 SCDIKLAIVRPLP-QLLRYSRSRGPPLFLCN-FIDSDP 197 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -1 Query: 244 ELQTLILSILDDPMVSRVFGES 179 ELQ LILSILDDP+VSRVFGE+ Sbjct: 137 ELQHLILSILDDPVVSRVFGEA 158 >ref|XP_002272110.1| PREDICTED: uncharacterized protein LOC100260392 [Vitis vinifera] Length = 1105 Score = 45.4 bits (106), Expect(2) = 5e-09 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -3 Query: 173 SSEIKIALLRPVHHQLLRYARYKGPPMFLCNLYGDSEP 60 S +IK+A++RP+ QLLRY+R +GPP+FLCN + DS+P Sbjct: 162 SCDIKLAIVRPLP-QLLRYSRSRGPPLFLCN-FIDSDP 197 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -1 Query: 244 ELQTLILSILDDPMVSRVFGES 179 ELQ LILSILDDP+VSRVFGE+ Sbjct: 137 ELQHLILSILDDPVVSRVFGEA 158 >emb|CBI25472.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 45.4 bits (106), Expect(2) = 5e-09 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -3 Query: 173 SSEIKIALLRPVHHQLLRYARYKGPPMFLCNLYGDSEP 60 S +IK+A++RP+ QLLRY+R +GPP+FLCN + DS+P Sbjct: 162 SCDIKLAIVRPLP-QLLRYSRSRGPPLFLCN-FIDSDP 197 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -1 Query: 244 ELQTLILSILDDPMVSRVFGES 179 ELQ LILSILDDP+VSRVFGE+ Sbjct: 137 ELQHLILSILDDPVVSRVFGEA 158 >ref|XP_002316210.1| predicted protein [Populus trichocarpa] gi|222865250|gb|EEF02381.1| predicted protein [Populus trichocarpa] Length = 468 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 20/40 (50%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -3 Query: 173 SSEIKIALLRPVHHQLLRYA--RYKGPPMFLCNLYGDSEP 60 SSEIK+A++RP+ Q+ +++ R+KGPP+FLCNL +P Sbjct: 166 SSEIKLAIVRPLP-QVFKFSSSRFKGPPLFLCNLLSSEDP 204 Score = 40.4 bits (93), Expect(2) = 1e-08 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -1 Query: 244 ELQTLILSILDDPMVSRVFGES 179 ELQ LILSILDDP+VSRVFGE+ Sbjct: 141 ELQNLILSILDDPVVSRVFGEA 162