BLASTX nr result
ID: Cephaelis21_contig00028188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028188 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031548.1| auxin response factor 11 [Arabidopsis thalia... 68 7e-10 ref|NP_182176.2| auxin response factor 11 [Arabidopsis thaliana]... 65 6e-09 dbj|BAF01593.1| ARF1 family auxin responsive transcription facto... 65 6e-09 ref|XP_002303662.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 emb|CAC83756.1| auxin response factor 1 [Oryza sativa Japonica G... 64 1e-08 >ref|NP_001031548.1| auxin response factor 11 [Arabidopsis thaliana] gi|238054388|sp|Q9ZPY6.3|ARFK_ARATH RecName: Full=Auxin response factor 11 gi|4415934|gb|AAD20164.1| putative ARF1 family auxin responsive transcription factor [Arabidopsis thaliana] gi|20197827|gb|AAM15267.1| putative ARF1 family auxin responsive transcription factor [Arabidopsis thaliana] gi|49616357|gb|AAT67075.1| ARF11 [Arabidopsis thaliana] gi|330255622|gb|AEC10716.1| auxin response factor 11 [Arabidopsis thaliana] Length = 622 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 27 LVYVNFSATEQEDVMFTELWKAYSGPLVHIPRPGERVFYFPQGHMEQ 167 L+ V ++ +D ++TELWKA +GPLV +PR GERVFYFPQGHMEQ Sbjct: 25 LIAVGWNLGSNDDELYTELWKACAGPLVEVPRYGERVFYFPQGHMEQ 71 >ref|NP_182176.2| auxin response factor 11 [Arabidopsis thaliana] gi|110739686|dbj|BAF01750.1| ARF1 family auxin responsive transcription factor like protein [Arabidopsis thaliana] gi|330255620|gb|AEC10714.1| auxin response factor 11 [Arabidopsis thaliana] Length = 601 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 60 EDVMFTELWKAYSGPLVHIPRPGERVFYFPQGHMEQ 167 +D ++TELWKA +GPLV +PR GERVFYFPQGHMEQ Sbjct: 15 DDELYTELWKACAGPLVEVPRYGERVFYFPQGHMEQ 50 >dbj|BAF01593.1| ARF1 family auxin responsive transcription factor like protein [Arabidopsis thaliana] Length = 601 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 60 EDVMFTELWKAYSGPLVHIPRPGERVFYFPQGHMEQ 167 +D ++TELWKA +GPLV +PR GERVFYFPQGHMEQ Sbjct: 15 DDELYTELWKACAGPLVEVPRYGERVFYFPQGHMEQ 50 >ref|XP_002303662.1| predicted protein [Populus trichocarpa] gi|222841094|gb|EEE78641.1| predicted protein [Populus trichocarpa] Length = 575 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 60 EDVMFTELWKAYSGPLVHIPRPGERVFYFPQGHMEQ 167 ED ++TELWKA +GPLV +P+ GERVFYFPQGHMEQ Sbjct: 14 EDDLYTELWKACAGPLVDVPKRGERVFYFPQGHMEQ 49 >emb|CAC83756.1| auxin response factor 1 [Oryza sativa Japonica Group] Length = 836 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +3 Query: 60 EDVMFTELWKAYSGPLVHIPRPGERVFYFPQGHMEQ--GHMQQVGLLSLHHFN 212 ED +FTELW A +GPLV +PR GE+VFYFPQGH+EQ QVG + +N Sbjct: 18 EDALFTELWSACAGPLVTVPRVGEKVFYFPQGHIEQVEASTNQVGEQRMQLYN 70