BLASTX nr result
ID: Cephaelis21_contig00028171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00028171 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_002284545.2| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 emb|CBI36131.3| unnamed protein product [Vitis vinifera] 83 3e-14 >ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 83.2 bits (204), Expect = 2e-14 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 342 ICLDCHAVIKFISNLTHREIIVRDINRFHHFKDGVCSCGDYW 217 +C DCHAV KFIS +REI+VRD+NRFHHFKDGVCSCGDYW Sbjct: 617 LCEDCHAVTKFISKFANREILVRDVNRFHHFKDGVCSCGDYW 658 >ref|XP_002284545.2| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 648 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 342 ICLDCHAVIKFISNLTHREIIVRDINRFHHFKDGVCSCGDYW 217 IC DCH IKFIS +T REI VRD+NR+HHFKDGVCSCGDYW Sbjct: 607 ICEDCHVAIKFISKITEREITVRDVNRYHHFKDGVCSCGDYW 648 >ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Brachypodium distachyon] Length = 654 Score = 82.8 bits (203), Expect = 3e-14 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 342 ICLDCHAVIKFISNLTHREIIVRDINRFHHFKDGVCSCGDYW 217 +C DCH+V KFIS T REI+VRD+NRFHHF+DGVCSCGDYW Sbjct: 613 LCEDCHSVTKFISKFTEREIVVRDVNRFHHFRDGVCSCGDYW 654 >ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Glycine max] Length = 778 Score = 82.8 bits (203), Expect = 3e-14 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 342 ICLDCHAVIKFISNLTHREIIVRDINRFHHFKDGVCSCGDYW 217 +CLDCHA KFIS +T R I+VRD NRFHHFKDG+CSCGDYW Sbjct: 737 VCLDCHAATKFISKITERVIVVRDANRFHHFKDGICSCGDYW 778 >emb|CBI36131.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 342 ICLDCHAVIKFISNLTHREIIVRDINRFHHFKDGVCSCGDYW 217 IC DCH IKFIS +T REI VRD+NR+HHFKDGVCSCGDYW Sbjct: 509 ICEDCHVAIKFISKITEREITVRDVNRYHHFKDGVCSCGDYW 550